Diaphorina citri psyllid: psy13435


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MKAKEEERKKEAKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCAKYFTKHHEKG
ccccccccccccccccccccccccccccEEEEEcccccccEEEEccccccccccccHHHHHHHcccccccccccc
***************LKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCAKYFT******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAKEEERKKEAKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCAKYFTKHHEKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044465 [BP]modulation of sensory perception of pain in other organismprobableGO:0044057, GO:0051930, GO:0051931, GO:0050789, GO:0031644, GO:0008150, GO:0051239, GO:0065007, GO:0065008, GO:0035821, GO:0051704
GO:0042151 [CC]nematocystprobableGO:0005737, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0043228, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0004867 [MF]serine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0044562 [BP]envenomation resulting in negative regulation of voltage-gated potassium channel activity in other organismprobableGO:0044559, GO:0050896, GO:0007610, GO:0008150, GO:0044560, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0019870 [MF]potassium channel inhibitor activityprobableGO:0016247, GO:0003674, GO:0015459, GO:0008200, GO:0016248
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ODY, chain E
Confidence level:very confident
Coverage over the Query: 10-68
View the alignment between query and template
View the model in PyMOL