Query         psy13436
Match_columns 67
No_of_seqs    163 out of 1030
Neff          8.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:23:12 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13436.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13436hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00109 KU BPTI/Kunitz family   99.9 4.4E-22 9.6E-27   99.5   5.7   54   12-65      1-54  (54)
  2 smart00131 KU BPTI/Kunitz fami  99.9   1E-21 2.2E-26   97.9   5.8   53   12-64      1-53  (53)
  3 PF00014 Kunitz_BPTI:  Kunitz/B  99.9 2.5E-21 5.4E-26   96.1   6.7   53   13-65      1-53  (53)
  4 KOG4295|consensus               99.6 4.1E-16 8.9E-21   98.4   5.4   58    9-66     74-134 (295)
  5 KOG4597|consensus               97.4 3.6E-05 7.8E-10   52.7   0.1   49   10-64    372-420 (560)
  6 KOG3540|consensus               97.0 0.00026 5.7E-09   48.7   1.2   54   12-65    108-161 (615)
  7 KOG4597|consensus               96.8  0.0013 2.8E-08   45.3   3.2   54   10-64    311-368 (560)
  8 KOG4295|consensus               70.5     1.5 3.2E-05   27.7   0.1   25   41-65      2-26  (295)
  9 PF00397 WW:  WW domain;  Inter  40.7      30 0.00064   14.6   1.7   13   27-39     14-26  (31)
 10 PLN00416 carbonate dehydratase  31.9      89  0.0019   20.2   3.5   21   25-45    228-248 (258)
 11 cd00201 WW Two conserved trypt  29.3      52  0.0011   13.3   1.6   12   28-39     13-24  (31)
 12 smart00456 WW Domain with 2 co  29.1      55  0.0012   13.4   1.6   12   28-39     14-25  (32)
 13 cd01099 PAN_AP_HGF Subfamily o  28.7      43 0.00094   17.2   1.4   12   55-66     25-36  (80)
 14 PF12904 Collagen_bind_2:  Puta  28.6      55  0.0012   17.8   1.8   16   26-41     48-63  (93)
 15 PF08276 PAN_2:  PAN-like domai  28.5      48   0.001   16.4   1.5   12   55-66     27-38  (66)
 16 PF01607 CBM_14:  Chitin bindin  28.2      48   0.001   14.9   1.4   12   30-41     35-46  (53)
 17 smart00473 PAN_AP divergent su  27.5      48   0.001   16.0   1.4   14   53-66     23-36  (78)
 18 PF12989 DUF3873:  Domain of un  27.0      43 0.00093   17.4   1.2   28   37-66     32-63  (69)
 19 cd01098 PAN_AP_plant Plant PAN  25.8      46   0.001   16.5   1.2   13   54-66     31-43  (84)
 20 PF14295 PAN_4:  PAN domain; PD  25.4      42 0.00091   15.1   0.9   13   53-65     14-26  (51)
 21 PF00355 Rieske:  Rieske [2Fe-2  24.4      85  0.0018   16.2   2.1   14   28-41     67-80  (97)
 22 cd01100 APPLE_Factor_XI_like S  23.1      68  0.0015   16.0   1.5   13   54-66     24-36  (73)
 23 PF12071 DUF3551:  Protein of u  22.2 1.1E+02  0.0024   16.2   2.3   26   37-63     31-56  (82)
 24 cd00129 PAN_APPLE PAN/APPLE-li  20.3      64  0.0014   16.9   1.1   14   53-66     23-36  (80)

No 1  
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold. BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure.
Probab=99.87  E-value=4.4e-22  Score=99.53  Aligned_cols=54  Identities=54%  Similarity=1.211  Sum_probs=51.8

Q ss_pred             CccccCCcccCCCCCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhcc
Q psy13436         12 AKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCA   65 (67)
Q Consensus        12 ~~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C~   65 (67)
                      ++|.+|++.|.|.+.+++||||+.+++|+.|.|+||++|.|+|.|+++|+++|.
T Consensus         1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~   54 (54)
T cd00109           1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG   54 (54)
T ss_pred             CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence            479999999999999999999999999999999999999999999999999995


No 2  
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors. Serine protease inhibitors. One member of the family is encoded by an alternatively-spliced form of Alzheimer's amyloid beta-protein.
Probab=99.86  E-value=1e-21  Score=97.91  Aligned_cols=53  Identities=57%  Similarity=1.173  Sum_probs=51.0

Q ss_pred             CccccCCcccCCCCCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhc
Q psy13436         12 AKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQC   64 (67)
Q Consensus        12 ~~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C   64 (67)
                      .+|.+|++.|.|.+..++||||+.+++|+.|.|.||++|.|+|.|+++|+++|
T Consensus         1 ~~C~~~~~~g~c~~~~~~w~yd~~~~~C~~f~~~gc~~n~N~F~t~~~C~~~C   53 (53)
T smart00131        1 DVCLLPPDTGPCGGSIPRYYYDPETGTCEPFTYGGCGGNANNFESLEECERTC   53 (53)
T ss_pred             CcccCCCCCCCCCCCeeEEEEeCCCCccceeECCCccCCCCCcCCHHHHHhhC
Confidence            47999999999999999999999999999999999999999999999999988


No 3  
>PF00014 Kunitz_BPTI:  Kunitz/Bovine pancreatic trypsin inhibitor domain;  InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus. They are short (~50 residue) alpha/beta proteins with few secondary structures. The fold is constrained by 3 disulphide bonds. The type example for this family is aprotinin (bovine pancreatic trypsin inhibitor) [] (or basic protease inhibitor), but the family includes numerous other members [, , , ], such as snake venom basic protease; mammalian inter-alpha-trypsin inhibitors; trypstatin, a rodent mast cell inhibitor of trypsin; a domain found in an alternatively-spliced form of Alzheimer's amyloid beta-protein; domains at the C-termini of the alpha(1) and alpha(3) chains of type VII and type VI collagens; and tissue factor pathway inhibitor precursor.; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1YC0_I 4DTG_K 1TFX_D 1ADZ_A 1BF0_A 3OFW_A 1SHP_A 3M7Q_B 3GYM_J 1BHC_G ....
Probab=99.86  E-value=2.5e-21  Score=96.08  Aligned_cols=53  Identities=42%  Similarity=1.029  Sum_probs=51.1

Q ss_pred             ccccCCcccCCCCCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhcc
Q psy13436         13 KCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCA   65 (67)
Q Consensus        13 ~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C~   65 (67)
                      +|.+|++.|.|.....+||||+.+++|+.|.+.||+++.|+|.|+++|+++|+
T Consensus         1 ~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~~c~~~~N~F~t~~~C~~~C~   53 (53)
T PF00014_consen    1 VCLLPPDEGPCSGNEPRWYYNPSTGRCEQFWYGGCGGNENNFPTEEECQKTCG   53 (53)
T ss_dssp             GGGSTCTCTSSSSCEEEEEEETTTTEEEEEEECSSSSSSSCBSSHHHHHHHHT
T ss_pred             CCCCCCcCCCCCCCccEEEEeCCCCcEEEeEccccCCCCcCCCCHHHHHHHcC
Confidence            59999999999999999999999999999999999999999999999999995


No 4  
>KOG4295|consensus
Probab=99.64  E-value=4.1e-16  Score=98.35  Aligned_cols=58  Identities=50%  Similarity=1.048  Sum_probs=54.4

Q ss_pred             cCCCccccCCcccCCC---CCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhccC
Q psy13436          9 KKEAKCHLKPVTGNCR---ASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCAK   66 (67)
Q Consensus         9 ~~~~~C~~p~~~g~C~---~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C~~   66 (67)
                      ....+|.+|.+.|.|.   ..+.|||||..+.+|.+|.|+||+||.|+|.|.++|...|..
T Consensus        74 ~~~~~C~~~~~~g~~~~~~~~~~r~~~d~~t~~C~~F~y~GC~gN~N~F~s~~~C~~~C~~  134 (295)
T KOG4295|consen   74 TKNEICDQPKDVGLCCCCGTGSPRYYFDPKTKTCQPFIYGGCGGNSNNFLSSEECERACGS  134 (295)
T ss_pred             CCCcccCCchhhcccccCCCceeeeEEcCCCCeEeeeeecCcCCCcCcccCHHHHHHHhcC
Confidence            5678999999999777   789999999999999999999999999999999999999975


No 5  
>KOG4597|consensus
Probab=97.41  E-value=3.6e-05  Score=52.65  Aligned_cols=49  Identities=27%  Similarity=0.558  Sum_probs=42.3

Q ss_pred             CCCccccCCcccCCCCCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhc
Q psy13436         10 KEAKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQC   64 (67)
Q Consensus        10 ~~~~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C   64 (67)
                      ..+.|.+|-..|+| ...+||+|++.+ +|.    ++|++|+|+|.+...|+..|
T Consensus       372 ~~pad~~pc~~GPC-~~e~rW~~s~ws-qCs----~eCg~g~~~r~vica~~~a~  420 (560)
T KOG4597|consen  372 PRPADTRPCAQGPC-PCEPRWAYSPWS-QCS----GECGGGGNNREVICACEQAC  420 (560)
T ss_pred             CCCccccccccCCC-CCccceeecchh-hhc----cccCCCCcceeEEEeeecCC
Confidence            45677888889999 778999999998 997    89999999999988887665


No 6  
>KOG3540|consensus
Probab=97.05  E-value=0.00026  Score=48.70  Aligned_cols=54  Identities=17%  Similarity=0.068  Sum_probs=49.4

Q ss_pred             CccccCCcccCCCCCeeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhcc
Q psy13436         12 AKCHLKPVTGNCRASLHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQCA   65 (67)
Q Consensus        12 ~~C~~p~~~g~C~~~~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C~   65 (67)
                      ..|..+..++.|....++|-|++--..|+-|...+|+++.|+|....+|+++|.
T Consensus       108 k~~~h~Vrp~~Cl~gefvseallvp~kC~ffh~ermD~cEn~~hwh~ea~etC~  161 (615)
T KOG3540|consen  108 KFCLHPVRPYRCLAGEFVSEALLVPEKCQFFHQERMDQCENNQHWHKEAMETCS  161 (615)
T ss_pred             cccCcccccceeecCcchhhhccCcccchhhhccccccccchHHHHHHHHHHhc
Confidence            445566678899999999999999999999999999999999999999999996


No 7  
>KOG4597|consensus
Probab=96.85  E-value=0.0013  Score=45.33  Aligned_cols=54  Identities=22%  Similarity=0.401  Sum_probs=45.5

Q ss_pred             CCCccccCCcccCCCCC----eeeEEEeCCCCceeEEEecCcCCCCCCcCCHHHHHHhc
Q psy13436         10 KEAKCHLKPVTGNCRAS----LHRYYFDTKTLTCTSFIYGGCGGNANNFVKRKDCERQC   64 (67)
Q Consensus        10 ~~~~C~~p~~~g~C~~~----~~~w~yn~~~~~C~~f~~~gC~gn~N~F~t~~~C~~~C   64 (67)
                      .++.|.. ++.|.|.+.    ..+|.|+..-+.|+.|...+|.++.++|.+.+.|+..|
T Consensus       311 ~~~e~~~-cdmgpC~g~~f~tew~~~~~aqcg~~~~~rsv~C~~s~~~~~p~E~C~~a~  368 (560)
T KOG4597|consen  311 KPAECLT-CDMGPCTGLTFVTEWSWHLDAQCGDCETTRSVVCKGSQGRFEPLEACLVAC  368 (560)
T ss_pred             CchhhcC-CCCcccCCccchhhhhhhcccccCCceeeeeeeecCccccccchhhhhhhc
Confidence            3455655 788888843    35677999999999999999999999999999999888


No 8  
>KOG4295|consensus
Probab=70.53  E-value=1.5  Score=27.69  Aligned_cols=25  Identities=52%  Similarity=1.178  Sum_probs=21.8

Q ss_pred             EEEecCcCCCCCCcCCHHHHHHhcc
Q psy13436         41 SFIYGGCGGNANNFVKRKDCERQCA   65 (67)
Q Consensus        41 ~f~~~gC~gn~N~F~t~~~C~~~C~   65 (67)
                      .|.+.||.++.|.|.+.++|...|.
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~   26 (295)
T KOG4295|consen    2 SFKYNGCPGNSNNFFSSEDCQVRCC   26 (295)
T ss_pred             CccccCCCCCccceeehhhhceeec
Confidence            4678899999999999999988764


No 9  
>PF00397 WW:  WW domain;  InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....
Probab=40.74  E-value=30  Score=14.62  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=9.5

Q ss_pred             eeeEEEeCCCCce
Q psy13436         27 LHRYYFDTKTLTC   39 (67)
Q Consensus        27 ~~~w~yn~~~~~C   39 (67)
                      -..||||..++.-
T Consensus        14 g~~YY~N~~t~~s   26 (31)
T PF00397_consen   14 GRPYYYNHETGES   26 (31)
T ss_dssp             SEEEEEETTTTEE
T ss_pred             CCEEEEeCCCCCE
Confidence            3568999888753


No 10 
>PLN00416 carbonate dehydratase
Probab=31.90  E-value=89  Score=20.16  Aligned_cols=21  Identities=5%  Similarity=-0.064  Sum_probs=17.2

Q ss_pred             CCeeeEEEeCCCCceeEEEec
Q psy13436         25 ASLHRYYFDTKTLTCTSFIYG   45 (67)
Q Consensus        25 ~~~~~w~yn~~~~~C~~f~~~   45 (67)
                      -.+..|+||..++.-..|.+.
T Consensus       228 l~I~G~~Ydl~TG~v~~~~~~  248 (258)
T PLN00416        228 LAIRGGHYNFVKGTFDLWELD  248 (258)
T ss_pred             cEEEEEEEECCCceEEEeccC
Confidence            357899999999999876654


No 11 
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=29.26  E-value=52  Score=13.25  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=9.0

Q ss_pred             eeEEEeCCCCce
Q psy13436         28 HRYYFDTKTLTC   39 (67)
Q Consensus        28 ~~w~yn~~~~~C   39 (67)
                      ..||||..+++-
T Consensus        13 ~~yy~n~~t~~s   24 (31)
T cd00201          13 RVYYYNHNTKET   24 (31)
T ss_pred             CEEEEECCCCCE
Confidence            578999887753


No 12 
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=29.07  E-value=55  Score=13.45  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=9.1

Q ss_pred             eeEEEeCCCCce
Q psy13436         28 HRYYFDTKTLTC   39 (67)
Q Consensus        28 ~~w~yn~~~~~C   39 (67)
                      ..||||..++.-
T Consensus        14 ~~yy~n~~t~~s   25 (32)
T smart00456       14 RPYYYNHETKET   25 (32)
T ss_pred             CEEEEECCCCCE
Confidence            668899888763


No 13 
>cd01099 PAN_AP_HGF Subfamily of PAN/APPLE-like domains; present in N-terminal (N) domains of plasminogen/hepatocyte growth factor proteins, and various proteins found in Bilateria, such as leech anti-platelet proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
Probab=28.73  E-value=43  Score=17.19  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=10.4

Q ss_pred             CCHHHHHHhccC
Q psy13436         55 VKRKDCERQCAK   66 (67)
Q Consensus        55 ~t~~~C~~~C~~   66 (67)
                      .|.++|...|..
T Consensus        25 ~s~~~C~~~C~~   36 (80)
T cd01099          25 ASLEECLRKCLE   36 (80)
T ss_pred             CCHHHHHHHhCC
Confidence            799999999964


No 14 
>PF12904 Collagen_bind_2:  Putative collagen-binding domain of a collagenase ;  InterPro: IPR024749 This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. The structure of one family member, Q8A905 from SWISSPROT, has been characterised. The domain occurs in the C-terminal region of the protein.; PDB: 3KZS_D.
Probab=28.63  E-value=55  Score=17.82  Aligned_cols=16  Identities=25%  Similarity=0.478  Sum_probs=12.0

Q ss_pred             CeeeEEEeCCCCceeE
Q psy13436         26 SLHRYYFDTKTLTCTS   41 (67)
Q Consensus        26 ~~~~w~yn~~~~~C~~   41 (67)
                      ....|+||+.+++=..
T Consensus        48 ~~~a~WfdPR~G~~~~   63 (93)
T PF12904_consen   48 KVKAWWFDPRTGKYTY   63 (93)
T ss_dssp             EEEEEEEETTT-BEEE
T ss_pred             ceeEEEEcCCCCCEEE
Confidence            3578999999988664


No 15 
>PF08276 PAN_2:  PAN-like domain;  InterPro: IPR013227 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions []. These domains contain a hair-pin loop like structure, similar to knottins, but the pattern of disulphide bonds differs
Probab=28.50  E-value=48  Score=16.41  Aligned_cols=12  Identities=33%  Similarity=0.922  Sum_probs=10.4

Q ss_pred             CCHHHHHHhccC
Q psy13436         55 VKRKDCERQCAK   66 (67)
Q Consensus        55 ~t~~~C~~~C~~   66 (67)
                      .+.++|+..|..
T Consensus        27 ~s~~~C~~~Cl~   38 (66)
T PF08276_consen   27 VSLEECEKACLS   38 (66)
T ss_pred             CCHHHHHhhcCC
Confidence            799999999964


No 16 
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=28.21  E-value=48  Score=14.91  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=8.4

Q ss_pred             EEEeCCCCceeE
Q psy13436         30 YYFDTKTLTCTS   41 (67)
Q Consensus        30 w~yn~~~~~C~~   41 (67)
                      .+||..+++|..
T Consensus        35 ~~fd~~~~~C~~   46 (53)
T PF01607_consen   35 LYFDPSSQRCVP   46 (53)
T ss_dssp             -EE-TTTSSEE-
T ss_pred             CEECcCcCEEcC
Confidence            589999999985


No 17 
>smart00473 PAN_AP divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
Probab=27.49  E-value=48  Score=16.02  Aligned_cols=14  Identities=14%  Similarity=0.638  Sum_probs=11.1

Q ss_pred             CcCCHHHHHHhccC
Q psy13436         53 NFVKRKDCERQCAK   66 (67)
Q Consensus        53 ~F~t~~~C~~~C~~   66 (67)
                      .-.+.++|+..|..
T Consensus        23 ~~~s~~~C~~~C~~   36 (78)
T smart00473       23 SVASLEECASKCLN   36 (78)
T ss_pred             cCCCHHHHHHHhCC
Confidence            35699999999964


No 18 
>PF12989 DUF3873:  Domain of unknown function, B. Theta Gene description (DUF3873);  InterPro: IPR024356 This entry represents a family of uncharacterised proteins found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].
Probab=27.01  E-value=43  Score=17.43  Aligned_cols=28  Identities=18%  Similarity=0.305  Sum_probs=17.1

Q ss_pred             CceeEEEecCcCCCCCCc----CCHHHHHHhccC
Q psy13436         37 LTCTSFIYGGCGGNANNF----VKRKDCERQCAK   66 (67)
Q Consensus        37 ~~C~~f~~~gC~gn~N~F----~t~~~C~~~C~~   66 (67)
                      ....+|.|  |..++..|    +|.+||++.+-.
T Consensus        32 ~~~~qYdY--r~~~GeLFscV~~tLeEcRr~rd~   63 (69)
T PF12989_consen   32 VTKYQYDY--RHTDGELFSCVAPTLEECRRLRDE   63 (69)
T ss_pred             ceEEEEee--ecCCccchhhhhccHHHHHHHHHH
Confidence            33444445  55566667    578888887643


No 19 
>cd01098 PAN_AP_plant Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.
Probab=25.81  E-value=46  Score=16.55  Aligned_cols=13  Identities=15%  Similarity=0.644  Sum_probs=10.1

Q ss_pred             cCCHHHHHHhccC
Q psy13436         54 FVKRKDCERQCAK   66 (67)
Q Consensus        54 F~t~~~C~~~C~~   66 (67)
                      -.+.++|++.|..
T Consensus        31 ~~s~~~C~~~Cl~   43 (84)
T cd01098          31 AISLEECREACLS   43 (84)
T ss_pred             cCCHHHHHHHHhc
Confidence            4588999999863


No 20 
>PF14295 PAN_4:  PAN domain; PDB: 2YIL_E 2YIP_C 2YIO_A.
Probab=25.43  E-value=42  Score=15.06  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=8.0

Q ss_pred             CcCCHHHHHHhcc
Q psy13436         53 NFVKRKDCERQCA   65 (67)
Q Consensus        53 ~F~t~~~C~~~C~   65 (67)
                      .-.|.++|...|.
T Consensus        14 ~~~s~~~C~~~C~   26 (51)
T PF14295_consen   14 TASSPEECQAACA   26 (51)
T ss_dssp             ----HHHHHHHHH
T ss_pred             cCCCHHHHHHHcc
Confidence            5668999999885


No 21 
>PF00355 Rieske:  Rieske [2Fe-2S] domain;  InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types. Two general types of [2Fe-2S] clusters are known and they differ in their coordinating residues. The ferredoxin-type [2Fe-2S] clusters are coordinated to the protein by four cysteine residues (see PDOC00175 from PROSITEDOC). The Rieske-type [2Fe-2S] cluster is coordinated to its protein by two cysteine residues and two histidine residues [, ]. The structure of several Rieske domains has been solved []. It contains three layers of antiparallel beta sheets forming two beta sandwiches. Both beta sandwiches share the central sheet 2. The metal-binding site is at the top of the beta sandwich formed by the sheets 2 and 3. The Fe1 iron of the Rieske cluster is coordinated by two cysteines while the other iron Fe2 is coordinated by two histidines. Two inorganic sulphide ions bridge the two iron ions forming a flat, rhombic cluster.  Rieske-type iron-sulphur clusters are common to electron transfer chains of mitochondria and chloroplast and to non-haem iron oxygenase systems:   The Rieske protein of the Ubiquinol-cytochrome c reductase (1.10.2.2 from EC) (also known as the bc1 complex or complex III), a complex of the electron transport chains of mitochondria and of some aerobic prokaryotes; it catalyses the oxidoreduction of ubiquinol and cytochrome c.  The Rieske protein of chloroplastic plastoquinone-plastocyanin reductase (1.10.99.1 from EC) (also known as the b6f complex). It is functionally similar to the bc1 complex and catalyses the oxidoreduction of plastoquinol and cytochrome f.  Bacterial naphthalene 1,2-dioxygenase subunit alpha, a component of the naphthalene dioxygenase (NDO) multicomponent enzyme system which catalyses the incorporation of both atoms of molecular oxygen into naphthalene to form cis-naphthalene dihydrodiol.  Bacterial 3-phenylpropionate dioxygenase ferredoxin subunit.  Bacterial toluene monoxygenase.  Bacterial biphenyl dioxygenase. ; GO: 0016491 oxidoreductase activity, 0051537 2 iron, 2 sulfur cluster binding, 0055114 oxidation-reduction process; PDB: 2XRX_A 2XR8_O 2XSH_G 2XSO_I 2YFI_C 2YFL_A 2YFJ_K 1G8J_D 1G8K_D 1NYK_B ....
Probab=24.40  E-value=85  Score=16.22  Aligned_cols=14  Identities=36%  Similarity=0.669  Sum_probs=12.0

Q ss_pred             eeEEEeCCCCceeE
Q psy13436         28 HRYYFDTKTLTCTS   41 (67)
Q Consensus        28 ~~w~yn~~~~~C~~   41 (67)
                      -.|.||..+++|..
T Consensus        67 Hg~~Fd~~tG~~~~   80 (97)
T PF00355_consen   67 HGWRFDLDTGECVG   80 (97)
T ss_dssp             TTEEEETTTSBEEE
T ss_pred             cCCEEeCCCceEec
Confidence            45999999999986


No 22 
>cd01100 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
Probab=23.06  E-value=68  Score=15.97  Aligned_cols=13  Identities=15%  Similarity=0.575  Sum_probs=10.4

Q ss_pred             cCCHHHHHHhccC
Q psy13436         54 FVKRKDCERQCAK   66 (67)
Q Consensus        54 F~t~~~C~~~C~~   66 (67)
                      -.+.++|++.|..
T Consensus        24 ~~s~~~Cq~~C~~   36 (73)
T cd01100          24 ASSAEQCQAACTA   36 (73)
T ss_pred             cCCHHHHHHHcCC
Confidence            3589999999964


No 23 
>PF12071 DUF3551:  Protein of unknown function (DUF3551);  InterPro: IPR021937  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 79 to 104 amino acids in length. This protein has a single completely conserved residue C that may be functionally important. 
Probab=22.19  E-value=1.1e+02  Score=16.23  Aligned_cols=26  Identities=12%  Similarity=0.107  Sum_probs=16.1

Q ss_pred             CceeEEEecCcCCCCCCcCCHHHHHHh
Q psy13436         37 LTCTSFIYGGCGGNANNFVKRKDCERQ   63 (67)
Q Consensus        37 ~~C~~f~~~gC~gn~N~F~t~~~C~~~   63 (67)
                      --|.+....|.. ....|.|.++|+..
T Consensus        31 p~Clq~~~~g~~-g~C~y~t~~QC~as   56 (82)
T PF12071_consen   31 PYCLQGGGWGYP-GDCSYSTYEQCRAS   56 (82)
T ss_pred             cEEEeCCCCCCC-ccCCcCCHHHHHHH
Confidence            346663233433 35689999999854


No 24 
>cd00129 PAN_APPLE PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins,  plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins. Common structural features include two disulfide bonds that link the alpha-helix to the central region of the protein. PAN domains have significant functional versatility, fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
Probab=20.29  E-value=64  Score=16.87  Aligned_cols=14  Identities=21%  Similarity=0.643  Sum_probs=11.0

Q ss_pred             CcCCHHHHHHhccC
Q psy13436         53 NFVKRKDCERQCAK   66 (67)
Q Consensus        53 ~F~t~~~C~~~C~~   66 (67)
                      ...+.++|...|..
T Consensus        23 ~~~s~~eC~~~Cl~   36 (80)
T cd00129          23 KANTADECANRCEK   36 (80)
T ss_pred             cccCHHHHHHHHhc
Confidence            34789999999864


Done!