Query         psy13443
Match_columns 188
No_of_seqs    147 out of 1277
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 19:33:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13443.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13443hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.9E-30 1.1E-34  179.0   4.2  134   12-157   129-266 (279)
  2 KOG2462|consensus               99.9 1.7E-25 3.8E-30  156.3   7.3  128   42-178   131-259 (279)
  3 KOG1074|consensus               99.8 3.9E-22 8.5E-27  157.1   1.2   85   77-161   604-695 (958)
  4 KOG1074|consensus               99.8 1.5E-21 3.3E-26  153.8   4.3   58  107-164   880-937 (958)
  5 KOG3608|consensus               99.8 9.3E-22   2E-26  141.7   2.7  161    1-162   195-380 (467)
  6 KOG3623|consensus               99.8 3.2E-21 6.9E-26  150.1   3.5   82   74-155   890-971 (1007)
  7 KOG3608|consensus               99.7 1.2E-17 2.6E-22  120.7   3.9  156   14-170   178-360 (467)
  8 KOG3576|consensus               99.7 2.8E-17   6E-22  110.4   3.0  115   11-162   115-240 (267)
  9 KOG3576|consensus               99.6 5.2E-17 1.1E-21  109.1   1.1   85   76-160   115-199 (267)
 10 KOG3623|consensus               99.6 1.4E-16   3E-21  124.6   2.4  111   13-158   210-333 (1007)
 11 PLN03086 PRLI-interacting fact  99.3 1.3E-11 2.9E-16   96.8   6.8  128   15-169   409-548 (567)
 12 PLN03086 PRLI-interacting fact  99.3 4.3E-11 9.3E-16   93.9   9.4  120   14-159   434-565 (567)
 13 PHA00733 hypothetical protein   99.2 6.4E-12 1.4E-16   81.1   3.7   83   76-160    38-125 (128)
 14 PHA00733 hypothetical protein   99.0 4.9E-10 1.1E-14   72.4   4.8   56   74-131    69-124 (128)
 15 PHA02768 hypothetical protein;  99.0 1.8E-10 3.8E-15   61.9   1.8   39  107-147     6-44  (55)
 16 PHA02768 hypothetical protein;  98.9 7.5E-10 1.6E-14   59.5   2.2   43   78-122     5-47  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.8 1.6E-09 3.5E-14   49.9   1.0   25    1-25      2-26  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.8 3.5E-09 7.6E-14   48.7   2.1   24  122-145     2-25  (26)
 19 PHA00616 hypothetical protein   98.7 1.4E-08   3E-13   52.0   1.8   33  134-166     1-33  (44)
 20 KOG3993|consensus               98.5 2.5E-08 5.4E-13   74.6   1.4   86   76-161   354-485 (500)
 21 KOG3993|consensus               98.5 1.8E-08 3.9E-13   75.4  -0.4   86   79-164   268-386 (500)
 22 PHA00616 hypothetical protein   98.5 4.3E-08 9.3E-13   50.2   1.1   33   78-110     1-33  (44)
 23 PHA00732 hypothetical protein   98.4 2.4E-07 5.3E-12   54.5   2.3   46   78-129     1-47  (79)
 24 PHA00732 hypothetical protein   98.3 1.1E-06 2.3E-11   51.8   3.1   47  106-158     1-48  (79)
 25 PF05605 zf-Di19:  Drought indu  98.2 4.9E-06 1.1E-10   45.5   4.3   49  107-158     3-53  (54)
 26 PF05605 zf-Di19:  Drought indu  98.1   6E-06 1.3E-10   45.1   4.4   50   78-130     2-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.0 4.1E-06   9E-11   37.2   1.8   22  135-156     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.0   5E-06 1.1E-10   37.2   2.1   24  135-158     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  98.0 5.4E-06 1.2E-10   36.8   1.7   22   79-100     1-22  (23)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.9 7.7E-06 1.7E-10   50.6   2.3   73   80-157     1-73  (100)
 31 COG5189 SFP1 Putative transcri  97.8 5.9E-06 1.3E-10   60.1   0.5   52  104-155   347-419 (423)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.8E-05 6.1E-10   34.6   2.3   24   14-37      1-24  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.3E-05 2.8E-10   37.1   1.0   25  134-158     1-25  (27)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.8E-05 6.1E-10   35.9   1.7   25   13-37      1-25  (27)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 6.8E-05 1.5E-09   46.3   2.7   73   15-101     1-73  (100)
 36 PF09237 GAGA:  GAGA factor;  I  97.4 0.00021 4.5E-09   37.5   2.6   31  132-162    22-52  (54)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.3 0.00019 4.1E-09   32.1   1.9   24  135-159     1-24  (24)
 38 COG5189 SFP1 Putative transcri  97.2  0.0001 2.3E-09   53.8   0.8   52   76-127   347-419 (423)
 39 smart00355 ZnF_C2H2 zinc finge  97.2 0.00036 7.7E-09   31.4   2.3   23  135-157     1-23  (26)
 40 PF09237 GAGA:  GAGA factor;  I  97.2 0.00048   1E-08   36.2   2.6   37    5-41     15-52  (54)
 41 smart00355 ZnF_C2H2 zinc finge  97.1 0.00067 1.4E-08   30.5   2.4   22   80-101     2-23  (26)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00086 1.9E-08   29.8   2.3   24   14-38      1-24  (24)
 43 PRK04860 hypothetical protein;  96.9 0.00078 1.7E-08   45.3   2.7   37  106-146   119-155 (160)
 44 PF12874 zf-met:  Zinc-finger o  96.9 0.00083 1.8E-08   30.2   1.7   21   14-34      1-21  (25)
 45 PF12874 zf-met:  Zinc-finger o  96.8 0.00072 1.6E-08   30.4   1.3   21   79-99      1-21  (25)
 46 PRK04860 hypothetical protein;  96.7  0.0014 3.1E-08   44.0   2.5   41   76-120   117-157 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  95.8   0.002 4.2E-08   29.6  -0.3   21  135-155     2-22  (27)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  95.7  0.0033 7.2E-08   28.8   0.3   22   79-100     2-23  (27)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.4   0.017 3.6E-07   26.0   2.1   21  135-156     3-23  (25)
 50 KOG1146|consensus               95.3  0.0033   7E-08   54.5  -0.9   81    8-100   460-540 (1406)
 51 KOG2231|consensus               95.2   0.044 9.6E-07   44.9   5.1  103   16-130   118-236 (669)
 52 smart00451 ZnF_U1 U1-like zinc  94.9   0.026 5.7E-07   27.4   2.1   23   12-34      2-24  (35)
 53 KOG1146|consensus               94.8   0.011 2.5E-07   51.3   0.9   56  101-156   460-540 (1406)
 54 COG5236 Uncharacterized conser  94.7   0.095 2.1E-06   39.4   5.3  134   13-159   151-306 (493)
 55 PF12013 DUF3505:  Protein of u  94.6   0.088 1.9E-06   33.1   4.5   83   76-159     9-109 (109)
 56 COG4049 Uncharacterized protei  94.6   0.016 3.5E-07   31.0   0.8   34    5-38      9-42  (65)
 57 cd00350 rubredoxin_like Rubred  94.6   0.031 6.7E-07   26.9   1.8   24  107-142     2-25  (33)
 58 TIGR00622 ssl1 transcription f  94.5   0.078 1.7E-06   33.3   3.9   24  106-129    81-104 (112)
 59 COG2888 Predicted Zn-ribbon RN  94.4   0.062 1.3E-06   29.3   2.8   46   64-114    12-58  (61)
 60 KOG2785|consensus               94.4    0.17 3.7E-06   38.5   6.0   57  107-163   167-250 (390)
 61 smart00451 ZnF_U1 U1-like zinc  94.3   0.048   1E-06   26.4   2.2   22   78-99      3-24  (35)
 62 KOG2482|consensus               94.1   0.084 1.8E-06   39.5   3.9   49  107-155   280-355 (423)
 63 KOG4173|consensus               94.0   0.037 7.9E-07   38.3   1.8   79   78-159    79-171 (253)
 64 COG4049 Uncharacterized protei  94.0   0.028 6.2E-07   30.1   1.0   30  131-160    14-43  (65)
 65 KOG2893|consensus               93.3   0.032 6.9E-07   39.6   0.6   42   80-125    12-53  (341)
 66 PRK14890 putative Zn-ribbon RN  92.8    0.15 3.3E-06   27.9   2.6   12   76-87     23-34  (59)
 67 PF06524 NOA36:  NOA36 protein;  91.5   0.062 1.3E-06   38.7   0.3   27  103-129   206-232 (314)
 68 cd00729 rubredoxin_SM Rubredox  91.4    0.17 3.7E-06   24.5   1.7   11  107-117     3-13  (34)
 69 PF12013 DUF3505:  Protein of u  91.2     0.8 1.7E-05   28.7   5.1   25  107-131    81-109 (109)
 70 COG5048 FOG: Zn-finger [Genera  90.6   0.051 1.1E-06   42.4  -0.9   65  106-170   289-359 (467)
 71 KOG2893|consensus               90.3    0.06 1.3E-06   38.2  -0.7   48  108-159    12-59  (341)
 72 PF07754 DUF1610:  Domain of un  89.9    0.34 7.3E-06   21.4   1.8   10   76-85     14-23  (24)
 73 PF13719 zinc_ribbon_5:  zinc-r  89.3    0.37   8E-06   23.8   1.9   13  108-120     4-16  (37)
 74 COG5048 FOG: Zn-finger [Genera  89.2   0.093   2E-06   40.9  -0.5   63   77-139   288-356 (467)
 75 PF10571 UPF0547:  Uncharacteri  88.6    0.36 7.7E-06   21.8   1.4   10   80-89     16-25  (26)
 76 COG1592 Rubrerythrin [Energy p  88.4    0.65 1.4E-05   31.5   3.2   25  105-142   133-157 (166)
 77 smart00659 RPOLCX RNA polymera  88.4     0.4 8.7E-06   24.7   1.7   26  107-143     3-28  (44)
 78 TIGR00622 ssl1 transcription f  88.1     1.7 3.7E-05   27.4   4.6   82   11-102    13-105 (112)
 79 PF13717 zinc_ribbon_4:  zinc-r  87.7    0.65 1.4E-05   22.8   2.2   13  108-120     4-16  (36)
 80 KOG2186|consensus               87.0    0.49 1.1E-05   34.1   2.0   47   78-127     3-49  (276)
 81 TIGR02098 MJ0042_CXXC MJ0042 f  86.8    0.59 1.3E-05   23.1   1.8   10  135-144    26-35  (38)
 82 KOG2482|consensus               86.4     1.2 2.7E-05   33.6   3.9   51   79-129   280-357 (423)
 83 PF15135 UPF0515:  Uncharacteri  86.3     1.3 2.7E-05   32.0   3.7   51   42-92    113-169 (278)
 84 PF09986 DUF2225:  Uncharacteri  86.2    0.13 2.9E-06   36.5  -1.1   13  135-147    49-61  (214)
 85 COG5236 Uncharacterized conser  86.1     1.2 2.5E-05   33.8   3.6   24   79-102   152-177 (493)
 86 PF09538 FYDLN_acid:  Protein o  85.9    0.53 1.1E-05   29.6   1.6   29   80-119    11-39  (108)
 87 PF09723 Zn-ribbon_8:  Zinc rib  85.9    0.48   1E-05   24.1   1.2   11   42-52      6-17  (42)
 88 PF02892 zf-BED:  BED zinc fing  85.6    0.61 1.3E-05   23.9   1.5   26  133-158    15-44  (45)
 89 smart00531 TFIIE Transcription  85.2    0.93   2E-05   30.2   2.6   35   11-49     97-131 (147)
 90 smart00834 CxxC_CXXC_SSSS Puta  84.8    0.63 1.4E-05   23.3   1.3    8   42-49      6-13  (41)
 91 TIGR00373 conserved hypothetic  84.2       1 2.2E-05   30.4   2.5   31   10-49    106-136 (158)
 92 PF09986 DUF2225:  Uncharacteri  84.1    0.17 3.8E-06   35.9  -1.3   13  107-119    49-61  (214)
 93 COG1996 RPC10 DNA-directed RNA  83.8    0.68 1.5E-05   24.4   1.2   11  106-116     6-16  (49)
 94 PF06524 NOA36:  NOA36 protein;  83.4    0.32   7E-06   35.1  -0.2   26  132-157   207-232 (314)
 95 PF05443 ROS_MUCR:  ROS/MUCR tr  82.3     0.7 1.5E-05   30.1   1.0   25  134-161    72-96  (132)
 96 TIGR00373 conserved hypothetic  81.3     1.9 4.2E-05   29.1   2.9   32  103-143   106-137 (158)
 97 PRK00464 nrdR transcriptional   80.6    0.33 7.2E-06   32.5  -0.9   17  106-122    28-44  (154)
 98 smart00614 ZnF_BED BED zinc fi  80.6     1.8 3.9E-05   22.8   2.1   23  136-158    20-47  (50)
 99 smart00531 TFIIE Transcription  80.5     4.1 8.8E-05   27.1   4.3   37  104-144    97-133 (147)
100 smart00734 ZnF_Rad18 Rad18-lik  80.4     1.8   4E-05   19.4   1.8   19  136-155     3-21  (26)
101 PF12907 zf-met2:  Zinc-binding  79.9     1.2 2.6E-05   22.5   1.2   27  135-161     2-31  (40)
102 TIGR02605 CxxC_CxxC_SSSS putat  79.1     1.2 2.7E-05   23.6   1.2   11   14-24      6-16  (52)
103 PRK06266 transcription initiat  78.5     1.6 3.5E-05   30.1   1.9   29   12-49    116-144 (178)
104 KOG2186|consensus               78.3     1.2 2.6E-05   32.2   1.2   54  107-163     4-57  (276)
105 KOG2231|consensus               78.2     3.9 8.5E-05   34.1   4.2   69   24-110   160-240 (669)
106 PRK06266 transcription initiat  78.2     1.7 3.7E-05   30.0   1.9   30  105-143   116-145 (178)
107 PHA00626 hypothetical protein   77.8     1.8   4E-05   23.4   1.5   11   79-89     24-34  (59)
108 TIGR02300 FYDLN_acid conserved  76.4     1.8 3.8E-05   27.9   1.5   15  105-119    25-39  (129)
109 KOG2807|consensus               76.3     4.9 0.00011   30.3   3.9   25  133-157   344-368 (378)
110 KOG2785|consensus               75.9     4.4 9.5E-05   31.2   3.6   52   77-128   165-242 (390)
111 PF02176 zf-TRAF:  TRAF-type zi  75.1     2.5 5.4E-05   23.1   1.7   41  105-145     8-53  (60)
112 COG5151 SSL1 RNA polymerase II  74.6     1.4 3.1E-05   32.8   0.8   91   63-158   310-412 (421)
113 PF15269 zf-C2H2_7:  Zinc-finge  74.1     3.1 6.7E-05   21.3   1.7   22   13-34     20-41  (54)
114 COG1198 PriA Primosomal protei  74.0       3 6.5E-05   35.4   2.6   29  100-143   456-484 (730)
115 PRK00398 rpoP DNA-directed RNA  73.8     2.2 4.7E-05   22.1   1.2    8   42-49      4-11  (46)
116 PF14353 CpXC:  CpXC protein     73.5     2.2 4.7E-05   27.6   1.4   14   78-91     38-51  (128)
117 COG1571 Predicted DNA-binding   72.9     1.9 4.1E-05   33.8   1.2   30   63-92    352-381 (421)
118 smart00661 RPOL9 RNA polymeras  71.3     3.3 7.2E-05   21.8   1.6   11   78-88     20-30  (52)
119 PRK09678 DNA-binding transcrip  70.5     1.3 2.7E-05   25.6  -0.2   14  133-146    26-41  (72)
120 PF15135 UPF0515:  Uncharacteri  70.4     4.3 9.2E-05   29.4   2.3   61   74-147   108-168 (278)
121 COG3357 Predicted transcriptio  69.9       3 6.6E-05   25.0   1.3   13  106-118    58-70  (97)
122 PF12760 Zn_Tnp_IS1595:  Transp  69.4     4.9 0.00011   20.8   1.9   28  106-142    18-45  (46)
123 PRK04023 DNA polymerase II lar  68.7     5.5 0.00012   34.9   3.0    8  135-142   664-671 (1121)
124 PF04959 ARS2:  Arsenite-resist  68.3     3.6 7.9E-05   29.3   1.7   29  132-160    75-103 (214)
125 PF03604 DNA_RNApol_7kD:  DNA d  68.0     3.1 6.8E-05   19.8   0.9    6   80-85     19-24  (32)
126 KOG1280|consensus               66.4      11 0.00023   28.9   3.8   22   78-99     79-100 (381)
127 KOG2593|consensus               66.0     4.9 0.00011   31.5   2.1   37    9-49    124-161 (436)
128 cd00730 rubredoxin Rubredoxin;  66.0       2 4.3E-05   22.9   0.0   11   14-24      2-12  (50)
129 KOG4118|consensus               65.8     3.2 6.9E-05   23.2   0.8   31  135-165    39-69  (74)
130 PF13240 zinc_ribbon_2:  zinc-r  63.0     5.2 0.00011   17.4   1.1    6   81-86     16-21  (23)
131 PRK00432 30S ribosomal protein  62.4     4.9 0.00011   21.3   1.1   10  106-115    37-46  (50)
132 KOG2593|consensus               62.0     8.1 0.00018   30.4   2.6   38  101-141   123-160 (436)
133 PF12773 DZR:  Double zinc ribb  61.9     6.4 0.00014   20.6   1.5    8   79-86     30-37  (50)
134 PRK14714 DNA polymerase II lar  61.2      12 0.00025   33.9   3.6   34   42-87    668-701 (1337)
135 TIGR00595 priA primosomal prot  61.1     6.4 0.00014   32.1   2.1   16  100-115   234-249 (505)
136 KOG1280|consensus               60.4      10 0.00022   28.9   2.8   40   10-49     76-117 (381)
137 smart00440 ZnF_C2C2 C2C2 Zinc   60.3      11 0.00023   18.9   2.1   13   77-89     27-39  (40)
138 smart00154 ZnF_AN1 AN1-like Zi  60.2     7.9 0.00017   19.3   1.6   13   78-90     12-24  (39)
139 PRK04023 DNA polymerase II lar  59.5      12 0.00026   33.0   3.4    8   42-49    627-634 (1121)
140 TIGR01206 lysW lysine biosynth  59.2     7.3 0.00016   21.1   1.4   10   14-23      3-12  (54)
141 KOG3408|consensus               57.5     6.1 0.00013   25.2   1.1   25  132-156    55-79  (129)
142 COG4957 Predicted transcriptio  56.7     7.2 0.00016   25.4   1.3   25  135-162    77-101 (148)
143 PRK14873 primosome assembly pr  56.5     7.5 0.00016   32.8   1.8   26  102-143   406-431 (665)
144 PF13451 zf-trcl:  Probable zin  56.2       7 0.00015   20.7   1.0   10  107-116     5-14  (49)
145 KOG3214|consensus               55.6     7.4 0.00016   23.9   1.2   13  107-119    48-60  (109)
146 KOG2907|consensus               54.2     4.6 9.9E-05   25.4   0.2   38  107-146    75-114 (116)
147 PRK14714 DNA polymerase II lar  53.1      17 0.00036   33.0   3.3   53   14-89    668-720 (1337)
148 COG4888 Uncharacterized Zn rib  53.0     7.6 0.00016   23.9   0.9    8   42-49     23-30  (104)
149 PF01096 TFIIS_C:  Transcriptio  52.7     6.3 0.00014   19.6   0.5   12   77-88     27-38  (39)
150 COG1571 Predicted DNA-binding   52.6     9.9 0.00021   30.0   1.8   29  108-147   352-380 (421)
151 COG3364 Zn-ribbon containing p  52.6      11 0.00023   23.3   1.5   16  105-120     1-16  (112)
152 COG5151 SSL1 RNA polymerase II  52.2      32  0.0007   26.0   4.2   25  105-129   387-411 (421)
153 KOG4173|consensus               52.1     9.1  0.0002   27.0   1.3   51  105-158    78-130 (253)
154 PRK00420 hypothetical protein;  51.9      11 0.00024   23.8   1.6   11   78-88     40-50  (112)
155 KOG3408|consensus               51.4      10 0.00023   24.2   1.4   25   10-34     54-78  (129)
156 COG1198 PriA Primosomal protei  51.0      11 0.00025   32.1   2.0   21   63-87    464-484 (730)
157 PF04959 ARS2:  Arsenite-resist  50.9     9.5 0.00021   27.2   1.3   30   10-39     74-103 (214)
158 PF07649 C1_3:  C1-like domain;  50.4      11 0.00025   17.3   1.2   10   77-86     14-23  (30)
159 PF08274 PhnA_Zn_Ribbon:  PhnA   50.3     7.2 0.00016   18.3   0.5    8  106-113    19-26  (30)
160 PF07975 C1_4:  TFIIH C1-like d  50.3       6 0.00013   21.1   0.2   20   78-97     21-40  (51)
161 PF07282 OrfB_Zn_ribbon:  Putat  49.8      16 0.00034   20.6   1.9   10  106-115    46-55  (69)
162 COG1655 Uncharacterized protei  49.2     3.2 6.8E-05   29.7  -1.2   39  105-143    18-71  (267)
163 PTZ00255 60S ribosomal protein  49.0      12 0.00026   22.6   1.4   14   77-90     53-66  (90)
164 PF13878 zf-C2H2_3:  zinc-finge  48.4      25 0.00054   17.7   2.3   23  135-157    14-38  (41)
165 KOG4167|consensus               48.3     4.8  0.0001   33.8  -0.5   27   11-37    790-816 (907)
166 PF04780 DUF629:  Protein of un  48.1      17 0.00037   29.2   2.5   32    8-39     52-83  (466)
167 KOG2636|consensus               47.5      15 0.00032   29.1   2.0   27    8-34    396-423 (497)
168 PF04780 DUF629:  Protein of un  47.2      15 0.00032   29.6   2.0   28  134-161    57-84  (466)
169 PF08792 A2L_zn_ribbon:  A2L zi  46.7      12 0.00026   17.9   0.9   11   78-88     21-31  (33)
170 PF03833 PolC_DP2:  DNA polymer  45.5       7 0.00015   33.6   0.0    8   42-49    656-663 (900)
171 TIGR00100 hypA hydrogenase nic  45.3      13 0.00029   23.6   1.3   12   78-89     70-81  (115)
172 KOG3002|consensus               45.1      61  0.0013   24.6   4.8  109   42-160    49-165 (299)
173 TIGR00280 L37a ribosomal prote  44.4      15 0.00032   22.3   1.3   12   78-89     53-64  (91)
174 COG1327 Predicted transcriptio  44.3     5.8 0.00013   26.4  -0.5   14  107-120    29-42  (156)
175 PF07191 zinc-ribbons_6:  zinc-  44.2     8.9 0.00019   22.0   0.3   10   78-87     17-26  (70)
176 KOG2807|consensus               43.7      57  0.0012   25.0   4.4   31  105-141   344-374 (378)
177 PF14311 DUF4379:  Domain of un  43.5      22 0.00048   19.0   1.8   12  107-118    29-40  (55)
178 COG3091 SprT Zn-dependent meta  43.4      21 0.00045   23.9   1.9   33   77-114   116-148 (156)
179 PRK03681 hypA hydrogenase nick  43.3      13 0.00027   23.7   0.9   12   78-89     70-81  (114)
180 TIGR00244 transcriptional regu  43.3     5.7 0.00012   26.4  -0.7   16  107-122    29-44  (147)
181 PRK12380 hydrogenase nickel in  42.7      17 0.00036   23.1   1.4   11   79-89     71-81  (113)
182 COG0068 HypF Hydrogenase matur  42.4     4.8  0.0001   33.8  -1.3   74   63-143   103-182 (750)
183 PF02084 Bindin:  Bindin;  Inte  41.8      14 0.00031   26.3   1.1   12  148-159   131-142 (238)
184 COG0068 HypF Hydrogenase matur  41.5     2.8   6E-05   35.1  -2.7   33   80-118   153-185 (750)
185 PF01428 zf-AN1:  AN1-like Zinc  41.4     9.5 0.00021   19.4   0.1   15   12-26     12-26  (43)
186 PF01363 FYVE:  FYVE zinc finge  41.3      15 0.00033   20.6   1.0    6   80-85     27-32  (69)
187 KOG1701|consensus               41.1      24 0.00053   27.9   2.3   13  106-118   427-439 (468)
188 PF05495 zf-CHY:  CHY zinc fing  41.1     6.3 0.00014   22.6  -0.6   30  106-143    41-70  (71)
189 COG3677 Transposase and inacti  41.0      13 0.00029   24.2   0.8   12  134-145    53-64  (129)
190 COG4530 Uncharacterized protei  40.7      17 0.00036   22.8   1.1   12  105-116    25-36  (129)
191 PF04423 Rad50_zn_hook:  Rad50   40.6      27 0.00059   18.6   1.9   11  108-118    22-32  (54)
192 PF12647 RNHCP:  RNHCP domain;   39.6      24 0.00051   21.5   1.6    8   42-49      5-12  (92)
193 PRK03976 rpl37ae 50S ribosomal  39.6      17 0.00037   22.0   1.0    9   41-49     36-44  (90)
194 PRK14559 putative protein seri  38.6      45 0.00098   28.3   3.6   24   63-89     29-52  (645)
195 PRK03564 formate dehydrogenase  38.4      16 0.00035   27.7   1.0   13  134-146   252-264 (309)
196 KOG4377|consensus               37.8      53  0.0012   26.0   3.6   21  139-159   408-428 (480)
197 COG1675 TFA1 Transcription ini  37.8      27  0.0006   24.1   1.9   17  103-119   110-126 (176)
198 cd04476 RPA1_DBD_C RPA1_DBD_C:  37.5      24 0.00053   23.8   1.7   26   63-88     36-61  (166)
199 PRK10220 hypothetical protein;  37.2      29 0.00063   21.8   1.8   15   77-91     19-33  (111)
200 PRK00564 hypA hydrogenase nick  37.1      18 0.00039   23.1   0.9   16   76-91     69-84  (117)
201 PRK03824 hypA hydrogenase nick  36.8      17 0.00037   23.8   0.8   16   76-91     68-83  (135)
202 COG1773 Rubredoxin [Energy pro  36.8      17 0.00037   19.7   0.7   15  106-120     3-17  (55)
203 KOG4124|consensus               36.6     4.6 9.9E-05   30.8  -2.1   50  105-154   348-418 (442)
204 KOG1842|consensus               36.6      21 0.00046   28.4   1.4   28  134-161    15-42  (505)
205 PF14803 Nudix_N_2:  Nudix N-te  36.5      24 0.00052   17.0   1.1    9   78-86     22-30  (34)
206 COG2331 Uncharacterized protei  36.5     9.4  0.0002   22.2  -0.4   28   14-49     13-41  (82)
207 COG1997 RPL43A Ribosomal prote  36.3      26 0.00057   21.0   1.4   13   77-89     52-64  (89)
208 PF11931 DUF3449:  Domain of un  35.3      12 0.00027   26.2   0.0   24   11-34     99-123 (196)
209 KOG4167|consensus               34.9     9.1  0.0002   32.3  -0.8   25  106-130   792-816 (907)
210 PF01780 Ribosomal_L37ae:  Ribo  34.6      11 0.00023   22.9  -0.4    9   41-49     35-43  (90)
211 TIGR00686 phnA alkylphosphonat  34.6      24 0.00053   22.1   1.2   13   78-90     19-31  (109)
212 PF13824 zf-Mss51:  Zinc-finger  33.8      40 0.00086   18.4   1.8   11  133-143    13-23  (55)
213 KOG2272|consensus               33.4     6.1 0.00013   28.7  -1.8   43   42-84    100-143 (332)
214 PF14369 zf-RING_3:  zinc-finge  33.3      27 0.00058   16.9   1.0    8   81-88     24-31  (35)
215 PF07503 zf-HYPF:  HypF finger;  33.3       4 8.7E-05   19.9  -1.9   12  134-145    21-32  (35)
216 PF01286 XPA_N:  XPA protein N-  33.3      29 0.00064   16.8   1.1    6   44-49      6-11  (34)
217 PRK05978 hypothetical protein;  33.3      31 0.00068   23.1   1.6    8   42-49     34-41  (148)
218 KOG0717|consensus               33.1      27 0.00059   28.0   1.5   34  135-168   461-495 (508)
219 KOG0717|consensus               33.0      31 0.00068   27.7   1.8   22   79-100   293-314 (508)
220 PRK12496 hypothetical protein;  33.0      23 0.00051   24.1   1.0   11   79-89    128-138 (164)
221 PF00130 C1_1:  Phorbol esters/  32.8      33 0.00072   17.9   1.4   11   76-86     26-36  (53)
222 COG1326 Uncharacterized archae  32.6      45 0.00097   23.4   2.3   11  134-144    30-40  (201)
223 cd00065 FYVE FYVE domain; Zinc  32.3      32  0.0007   18.3   1.4    9   81-89      5-13  (57)
224 smart00731 SprT SprT homologue  32.1      34 0.00074   22.6   1.7   11   78-88    112-122 (146)
225 PF08646 Rep_fac-A_C:  Replicat  32.1      16 0.00035   24.1   0.2   26   63-88     20-47  (146)
226 KOG4727|consensus               31.9      33 0.00071   23.5   1.5   24   11-34     73-96  (193)
227 COG5188 PRP9 Splicing factor 3  31.7      33 0.00072   26.4   1.7   27    7-33    368-395 (470)
228 PF03107 C1_2:  C1 domain;  Int  31.5      40 0.00087   15.5   1.4    8   78-85     15-22  (30)
229 COG1594 RPB9 DNA-directed RNA   31.4      41 0.00088   21.4   1.8   16   11-26     20-35  (113)
230 PF01155 HypA:  Hydrogenase exp  31.4     8.5 0.00019   24.3  -1.2   14   78-91     70-83  (113)
231 PLN03238 probable histone acet  31.3      49  0.0011   24.8   2.5   26  133-158    47-72  (290)
232 PF14446 Prok-RING_1:  Prokaryo  31.3      64  0.0014   17.5   2.3    8   79-86     22-29  (54)
233 TIGR00627 tfb4 transcription f  31.0      41  0.0009   25.2   2.1   11  107-117   256-266 (279)
234 TIGR01384 TFS_arch transcripti  30.8      44 0.00095   20.6   1.9   36  107-145    63-101 (104)
235 KOG2636|consensus               30.8      48   0.001   26.5   2.4   23  105-127   400-423 (497)
236 PF11789 zf-Nse:  Zinc-finger o  30.4      36 0.00079   18.5   1.3   13   77-89     23-35  (57)
237 PF08790 zf-LYAR:  LYAR-type C2  30.3     7.7 0.00017   17.8  -1.1    9  108-116     2-10  (28)
238 PF10276 zf-CHCC:  Zinc-finger   30.1      18 0.00039   18.2   0.1   11  134-144    29-39  (40)
239 PHA02998 RNA polymerase subuni  30.1      58  0.0012   22.5   2.4   14   78-91    171-184 (195)
240 PF06397 Desulfoferrod_N:  Desu  29.9      22 0.00047   17.5   0.3   11   13-23      6-16  (36)
241 PF03811 Zn_Tnp_IS1:  InsA N-te  29.8      18 0.00039   17.7   0.0   13  100-112    23-35  (36)
242 PLN02294 cytochrome c oxidase   29.8      28  0.0006   23.8   0.9   16  132-147   139-154 (174)
243 PF08271 TF_Zn_Ribbon:  TFIIB z  29.6      39 0.00084   17.0   1.3    7   43-49      2-8   (43)
244 cd00924 Cyt_c_Oxidase_Vb Cytoc  29.3      29 0.00062   21.4   0.9   13  133-145    78-90  (97)
245 PF01927 Mut7-C:  Mut7-C RNAse   29.0      36 0.00077   22.6   1.4   11   78-88    124-134 (147)
246 PF10263 SprT-like:  SprT-like   29.0      21 0.00045   23.8   0.2   11   78-88    123-133 (157)
247 TIGR01562 FdhE formate dehydro  28.8      23  0.0005   26.8   0.5   12   75-86    207-218 (305)
248 PF08209 Sgf11:  Sgf11 (transcr  28.8      39 0.00084   16.2   1.1   21   78-99      4-24  (33)
249 KOG3507|consensus               28.7      34 0.00074   18.8   1.0   10  106-115    37-46  (62)
250 PRK04351 hypothetical protein;  28.6      33 0.00071   23.0   1.1   11  106-116   132-142 (149)
251 PF10013 DUF2256:  Uncharacteri  28.4      45 0.00098   17.0   1.3   16   15-30     10-25  (42)
252 PF05191 ADK_lid:  Adenylate ki  28.3      33 0.00072   16.7   0.8    9   15-23      3-11  (36)
253 KOG0320|consensus               28.2      11 0.00023   26.0  -1.2    7   42-48    132-138 (187)
254 COG4306 Uncharacterized protei  28.1      14  0.0003   23.7  -0.6   13   79-91     69-81  (160)
255 PF00301 Rubredoxin:  Rubredoxi  28.1      28 0.00061   18.2   0.6   36  107-143     2-43  (47)
256 PF09845 DUF2072:  Zn-ribbon co  27.9      30 0.00066   22.5   0.8   12  135-146     2-13  (131)
257 COG2879 Uncharacterized small   27.9      73  0.0016   17.8   2.2   19  146-164    24-42  (65)
258 PF13453 zf-TFIIB:  Transcripti  27.5      90  0.0019   15.4   2.5   15   80-94     21-35  (41)
259 PF07295 DUF1451:  Protein of u  27.4      30 0.00064   23.1   0.8    7  107-113   113-119 (146)
260 PF11781 RRN7:  RNA polymerase   27.3      39 0.00084   16.5   1.0   11   75-85     22-32  (36)
261 PF00628 PHD:  PHD-finger;  Int  27.2      55  0.0012   16.9   1.7   14   75-88     11-24  (51)
262 PF04606 Ogr_Delta:  Ogr/Delta-  26.7      41 0.00089   17.4   1.1    6   44-49      2-7   (47)
263 COG4896 Uncharacterized protei  26.5      34 0.00073   19.0   0.7   18   15-32      4-22  (68)
264 KOG1842|consensus               26.3      40 0.00087   26.9   1.4   28   13-40     15-42  (505)
265 PF09332 Mcm10:  Mcm10 replicat  26.1      16 0.00035   28.1  -0.7   37   13-49    252-293 (344)
266 PRK14892 putative transcriptio  25.9      33 0.00072   21.2   0.7   12  107-118    43-54  (99)
267 COG1998 RPS31 Ribosomal protei  25.5      48   0.001   17.6   1.2   10  106-115    37-46  (51)
268 TIGR00570 cdk7 CDK-activating   25.5      49  0.0011   25.1   1.7   11   79-89     44-54  (309)
269 cd00029 C1 Protein kinase C co  25.4      49  0.0011   16.8   1.3    7   79-85     29-35  (50)
270 COG1645 Uncharacterized Zn-fin  25.2      43 0.00093   21.9   1.2    8   42-49     29-36  (131)
271 TIGR03830 CxxCG_CxxCG_HTH puta  25.2      88  0.0019   19.8   2.7   22   77-98     30-51  (127)
272 PF06677 Auto_anti-p27:  Sjogre  24.7      51  0.0011   16.7   1.2    7   43-49     19-25  (41)
273 PRK05580 primosome assembly pr  24.6      55  0.0012   28.0   2.0   21   63-87    410-430 (679)
274 PF15616 TerY-C:  TerY-C metal   24.6      51  0.0011   21.6   1.4   10  106-115   105-114 (131)
275 PF06220 zf-U1:  U1 zinc finger  24.2      62  0.0013   15.9   1.4   21   13-33      3-25  (38)
276 PF05129 Elf1:  Transcription e  24.2      30 0.00065   20.5   0.3    8   42-49     23-30  (81)
277 PF09963 DUF2197:  Uncharacteri  24.2      38 0.00081   18.5   0.6    9  134-142    31-39  (56)
278 PF14255 Cys_rich_CPXG:  Cystei  24.1      39 0.00085   18.1   0.7   11  135-145     1-11  (52)
279 PF10122 Mu-like_Com:  Mu-like   23.8      27 0.00058   18.6   0.0    7   43-49      6-12  (51)
280 KOG1940|consensus               23.8 1.4E+02  0.0029   22.5   3.6   19   14-33    197-215 (276)
281 smart00064 FYVE Protein presen  23.1      79  0.0017   17.5   1.9   10   80-89     12-21  (68)
282 TIGR00319 desulf_FeS4 desulfof  23.0      37  0.0008   16.1   0.4   11   13-23      7-17  (34)
283 cd00974 DSRD Desulforedoxin (D  22.9      38 0.00083   16.0   0.5   10   13-22      4-13  (34)
284 smart00249 PHD PHD zinc finger  22.7      81  0.0018   15.3   1.8   13   76-88     12-24  (47)
285 PF10083 DUF2321:  Uncharacteri  22.7      75  0.0016   21.5   1.9   15   77-91     67-81  (158)
286 KOG0978|consensus               22.7      13 0.00027   31.5  -2.0   13  107-119   679-691 (698)
287 PF02591 DUF164:  Putative zinc  22.6      76  0.0016   17.0   1.7   11  104-114    44-54  (56)
288 PF02150 RNA_POL_M_15KD:  RNA p  22.5      27 0.00058   16.9  -0.1    8   80-87     22-29  (35)
289 PF04810 zf-Sec23_Sec24:  Sec23  22.5      81  0.0018   15.6   1.7   10   77-86     23-32  (40)
290 PF11023 DUF2614:  Protein of u  22.3      63  0.0014   20.5   1.4   15  107-121    86-100 (114)
291 PF14569 zf-UDP:  Zinc-binding   22.0 1.8E+02   0.004   17.1   3.4    6   80-85     30-35  (80)
292 PHA02942 putative transposase;  21.9      74  0.0016   25.0   2.1   14  105-118   341-354 (383)
293 COG5112 UFD2 U1-like Zn-finger  21.1      38 0.00083   21.1   0.3   23  134-156    55-77  (126)
294 PTZ00448 hypothetical protein;  21.0      74  0.0016   24.8   1.9   24   78-101   314-337 (373)
295 KOG0782|consensus               20.8      12 0.00026   30.7  -2.3   51   93-148   240-290 (1004)
296 KOG2906|consensus               20.8      51  0.0011   20.3   0.8   15   77-91     20-34  (105)
297 PTZ00303 phosphatidylinositol   20.7      81  0.0017   27.5   2.1    9   16-24    463-471 (1374)
298 TIGR01385 TFSII transcription   20.5 1.9E+02  0.0041   22.0   3.9   13   77-89    285-297 (299)
299 COG1656 Uncharacterized conser  20.3      73  0.0016   21.8   1.6   13  107-119   131-143 (165)
300 PLN00104 MYST -like histone ac  20.2      70  0.0015   25.8   1.7   30  133-162   197-226 (450)
301 PTZ00064 histone acetyltransfe  20.2      80  0.0017   25.9   1.9   29  134-162   280-308 (552)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=4.9e-30  Score=179.01  Aligned_cols=134  Identities=26%  Similarity=0.514  Sum_probs=120.2

Q ss_pred             CccccCCCcccccCHHHHHHHHHhhhcC--Cc-ccCCCCCC-cccccccccccccccccccccccCCCCceeecCCCCCC
Q psy13443         12 QQFECDFCPYGAKQAADVHNHVQQIHMG--VN-FVCVHCKQ-FEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYH   87 (188)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~--~~-~~C~~C~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~   87 (188)
                      ..|+|+.|++.+.+..+|.+|.|.|-..  ++ +.|..|++ +.+...++.|++.            ...++.|.+||+.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT------------H~l~c~C~iCGKa  196 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT------------HTLPCECGICGKA  196 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc------------cCCCccccccccc
Confidence            4599999999999999999998544432  22 99999999 7777778888774            3568999999999


Q ss_pred             CCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHh
Q psy13443         88 TPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKV  157 (188)
Q Consensus        88 f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  157 (188)
                      |...+.|+.|+++|+|+|||.|+.|+++|...++|+.|+++|.+.++|+|..|+++|...+.|.+|.+..
T Consensus       197 FSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  197 FSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             ccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            9999999999999999999999999999999999999999999999999999999999999999998754


No 2  
>KOG2462|consensus
Probab=99.92  E-value=1.7e-25  Score=156.32  Aligned_cols=128  Identities=25%  Similarity=0.471  Sum_probs=116.1

Q ss_pred             ccCCCCCC-cccccccccccccccccccccccCCCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCch
Q psy13443         42 FVCVHCKQ-FEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKT  120 (188)
Q Consensus        42 ~~C~~C~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~  120 (188)
                      |+|+.|++ ......+..|...+|+.       +..+.+.|+.|++.|.+-..|.+|+++|+  .+..|.+||+.|.+.+
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~-------~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPW  201 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSL-------DSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPW  201 (279)
T ss_pred             eeccccccccccccccchhhcccccc-------cccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchH
Confidence            89999999 77777788888877766       44677899999999999999999999998  5799999999999999


Q ss_pred             hHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcCCCCCCCCcchhhhHHhhhh
Q psy13443        121 HLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHKVDKKGGEEEEEEEEEEEEE  178 (188)
Q Consensus       121 ~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~~~~~~~~  178 (188)
                      .|+.|+|+|+|+|||.|+.|+++|..+++|..|+++|...+.|.|..+-..+.-.+-.
T Consensus       202 LLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyL  259 (279)
T KOG2462|consen  202 LLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYL  259 (279)
T ss_pred             HhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999988776655543


No 3  
>KOG1074|consensus
Probab=99.84  E-value=3.9e-22  Score=157.06  Aligned_cols=85  Identities=26%  Similarity=0.523  Sum_probs=77.9

Q ss_pred             ceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCC----CccCC---CCcccccCcHH
Q psy13443         77 YTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEK----PHACG---MCGYECAQGSQ  149 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~----~~~C~---~C~~~f~~~~~  149 (188)
                      .|.+|-+|.++...++.|+.|.++|+|++||+|.+||++|.++.+|+.|+.+|....    ++.|+   +|.+.|...-.
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            468899999999999999999999999999999999999999999999999987543    38899   99999999999


Q ss_pred             HHHHHHHhcCCC
Q psy13443        150 LMQHLRKVHKVD  161 (188)
Q Consensus       150 l~~H~~~~h~~~  161 (188)
                      |..|++.|.++.
T Consensus       684 lpQhIriH~~~~  695 (958)
T KOG1074|consen  684 LPQHIRIHLGGQ  695 (958)
T ss_pred             ccceEEeecCCC
Confidence            999999988543


No 4  
>KOG1074|consensus
Probab=99.84  E-value=1.5e-21  Score=153.81  Aligned_cols=58  Identities=28%  Similarity=0.485  Sum_probs=54.4

Q ss_pred             eecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcCCCCCC
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHKVDKKG  164 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  164 (188)
                      ..|.+|++.|...+.|+.|+++|++++||.|.+|++.|.+...|+.|+.+|+...++.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCc
Confidence            6899999999999999999999999999999999999999999999999998766653


No 5  
>KOG3608|consensus
Probab=99.84  E-value=9.3e-22  Score=141.70  Aligned_cols=161  Identities=22%  Similarity=0.450  Sum_probs=132.5

Q ss_pred             ChhHHhhccCCCccccCCCcccccCHHHHHHHHHhhhcC--CcccCCCCCC-ccccccccccccc-----cccccccccc
Q psy13443          1 MLRHVRTHLAKQQFECDFCPYGAKQAADVHNHVQQIHMG--VNFVCVHCKQ-FEVVPTRKTQTLE-----HCATCVDMVR   72 (188)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~--~~~~C~~C~~-~~~~~~~~~~~~~-----~c~~c~~~~~   72 (188)
                      |+.|+++|++++...|+.||.-|.++..|..|+++....  .+|+|..|.+ |.....+..|...     .|+.|..+..
T Consensus       195 LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~  274 (467)
T KOG3608|consen  195 LREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCS  274 (467)
T ss_pred             HHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCC
Confidence            578999999999999999999999999999998654432  3499999988 7776655555544     6777755544


Q ss_pred             C------------CCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceeccc--CccccCCchhHHHHHHhhc-C--CCCc
Q psy13443         73 P------------DASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCAL--CAYSARRKTHLDDHMRRHT-G--EKPH  135 (188)
Q Consensus        73 ~------------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~~~~~~~l~~H~~~h~-~--~~~~  135 (188)
                      .            ..++||+|..|++.|...+.|..|+.+|. +-.|.|..  |..++.+..++..|++.++ |  ..+|
T Consensus       275 ~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y  353 (467)
T KOG3608|consen  275 SASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILY  353 (467)
T ss_pred             ChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCce
Confidence            3            66889999999999999999999999888 55789977  9999999999999988765 4  3459


Q ss_pred             cCCCCcccccCcHHHHHHHHHhcCCCC
Q psy13443        136 ACGMCGYECAQGSQLMQHLRKVHKVDK  162 (188)
Q Consensus       136 ~C~~C~~~f~~~~~l~~H~~~~h~~~~  162 (188)
                      .|-.|++.|++..+|..|+...|+-+.
T Consensus       354 ~CH~Cdr~ft~G~~L~~HL~kkH~f~~  380 (467)
T KOG3608|consen  354 ACHCCDRFFTSGKSLSAHLMKKHGFRL  380 (467)
T ss_pred             eeecchhhhccchhHHHHHHHhhcccC
Confidence            999999999999999999998887554


No 6  
>KOG3623|consensus
Probab=99.82  E-value=3.2e-21  Score=150.09  Aligned_cols=82  Identities=28%  Similarity=0.640  Sum_probs=77.4

Q ss_pred             CCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHH
Q psy13443         74 DASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQH  153 (188)
Q Consensus        74 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  153 (188)
                      +.+..|.|.+|+++|.-.+.|.+|.--|+|++||.|.+|.++|..+-.|..|+|.|.|++||+|+.|+++|...+....|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhh
Confidence            44456999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HH
Q psy13443        154 LR  155 (188)
Q Consensus       154 ~~  155 (188)
                      +.
T Consensus       970 MN  971 (1007)
T KOG3623|consen  970 MN  971 (1007)
T ss_pred             hc
Confidence            84


No 7  
>KOG3608|consensus
Probab=99.69  E-value=1.2e-17  Score=120.69  Aligned_cols=156  Identities=22%  Similarity=0.451  Sum_probs=120.6

Q ss_pred             ccc--CCCcccccCHHHHHHHHHhhhcCCcccCCCCCC-ccccccccccccc---------ccccccccccC--------
Q psy13443         14 FEC--DFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQ-FEVVPTRKTQTLE---------HCATCVDMVRP--------   73 (188)
Q Consensus        14 ~~C--~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~-~~~~~~~~~~~~~---------~c~~c~~~~~~--------   73 (188)
                      +.|  ..|-+.|.++..|..|++.+.+++...|+.|+. |.....+..|.+.         .|..|.+.|..        
T Consensus       178 ~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv  257 (467)
T KOG3608|consen  178 TMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV  257 (467)
T ss_pred             eeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH
Confidence            456  468899999999999995554555599999999 6665555555443         68888877776        


Q ss_pred             -CCCceeecCCCCCCCCCHHHHHHHHH-hcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCC--CcccccCcHH
Q psy13443         74 -DASYTYMCYLCNYHTPTRKYMRTHID-THNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGM--CGYECAQGSQ  149 (188)
Q Consensus        74 -~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~  149 (188)
                       .....|+|+.|+.+....++|..|++ .|...|||+|..|...+.+.+.|..|...|. +..|+|..  |.+.|.+..+
T Consensus       258 ~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q  336 (467)
T KOG3608|consen  258 VRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQ  336 (467)
T ss_pred             HHhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHH
Confidence             33345888888888888888888887 5667888888888888888888888888886 56688887  8888888888


Q ss_pred             HHHHHHHhc-C--CCCCCCCcchh
Q psy13443        150 LMQHLRKVH-K--VDKKGGEEEEE  170 (188)
Q Consensus       150 l~~H~~~~h-~--~~~~~~~~~~~  170 (188)
                      |.+|++.+| +  .-+|+|-.++.
T Consensus       337 ~~~H~~evhEg~np~~Y~CH~Cdr  360 (467)
T KOG3608|consen  337 MRRHFLEVHEGNNPILYACHCCDR  360 (467)
T ss_pred             HHHHHHHhccCCCCCceeeecchh
Confidence            888888877 3  33467766654


No 8  
>KOG3576|consensus
Probab=99.67  E-value=2.8e-17  Score=110.39  Aligned_cols=115  Identities=23%  Similarity=0.528  Sum_probs=88.6

Q ss_pred             CCccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCCCCC
Q psy13443         11 KQQFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPT   90 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~   90 (188)
                      ...|.|.+|++.|....-|.+|+ ..|..                                    .+.+.|..||++|..
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~-kch~~------------------------------------vkr~lct~cgkgfnd  157 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHL-KCHSD------------------------------------VKRHLCTFCGKGFND  157 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHh-hhccH------------------------------------HHHHHHhhccCcccc
Confidence            34578888888888888888887 44432                                    234567778888888


Q ss_pred             HHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcC-----------CCCccCCCCcccccCcHHHHHHHHHhcC
Q psy13443         91 RKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTG-----------EKPHACGMCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus        91 ~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      ...|..|+++|+|.+||+|..|+++|...-.|..|++.-+|           .+-|.|..||.+-.....+..|+..+|+
T Consensus       158 tfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  158 TFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             hhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            88888888888888888888888888888888888764332           4558888898888888888888888886


Q ss_pred             CCC
Q psy13443        160 VDK  162 (188)
Q Consensus       160 ~~~  162 (188)
                      ..+
T Consensus       238 ~Sp  240 (267)
T KOG3576|consen  238 FSP  240 (267)
T ss_pred             CCH
Confidence            554


No 9  
>KOG3576|consensus
Probab=99.63  E-value=5.2e-17  Score=109.09  Aligned_cols=85  Identities=28%  Similarity=0.594  Sum_probs=81.5

Q ss_pred             CceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHH
Q psy13443         76 SYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  155 (188)
                      ...|.|.+|++.|....-|..|++-|...+.+-|..||+.|...-.|.+|+++|+|-+||+|..|+++|++.-.|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            45699999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCC
Q psy13443        156 KVHKV  160 (188)
Q Consensus       156 ~~h~~  160 (188)
                      ..|+.
T Consensus       195 kvhgv  199 (267)
T KOG3576|consen  195 KVHGV  199 (267)
T ss_pred             HHcCc
Confidence            99973


No 10 
>KOG3623|consensus
Probab=99.62  E-value=1.4e-16  Score=124.65  Aligned_cols=111  Identities=26%  Similarity=0.620  Sum_probs=92.2

Q ss_pred             ccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCCCCCHH
Q psy13443         13 QFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPTRK   92 (188)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~   92 (188)
                      ...|+.|.+.+.....|+.|+...|...                                   +..|.|.+|.++|..+.
T Consensus       210 lltcpycdrgykrltslkeHikyrhekn-----------------------------------e~nfsC~lCsytFAyRt  254 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKN-----------------------------------EPNFSCMLCSYTFAYRT  254 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhC-----------------------------------CCCCcchhhhhhhhhHH
Confidence            4689999999999999999997766422                                   33467888888999999


Q ss_pred             HHHHHHHhcCCC-------------CceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhc
Q psy13443         93 YMRTHIDTHNGE-------------KPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus        93 ~l~~H~~~h~~~-------------~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      .|.+|+.+|...             +.|+|..|+++|..+-.|..|+|+|.|++||.|+.|+++|...+.+..|+....
T Consensus       255 QLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSSKK  333 (1007)
T KOG3623|consen  255 QLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKK  333 (1007)
T ss_pred             HHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccccc
Confidence            999998877532             458999999999999999999999999999999999999999999888885443


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.26  E-value=1.3e-11  Score=96.76  Aligned_cols=128  Identities=18%  Similarity=0.301  Sum_probs=80.4

Q ss_pred             ccCCCcccccCHHHHHHHHHhhhcCCcccCCC--CCCcccccccccccccccccccccccCCCCceeecCCCCCCCCCHH
Q psy13443         15 ECDFCPYGAKQAADVHNHVQQIHMGVNFVCVH--CKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPTRK   92 (188)
Q Consensus        15 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~   92 (188)
                      .|+.|..... ..+|..|. .......-.|+.  |+.......+                   ++.+.|+.|++.|. ..
T Consensus       409 ~C~NC~~~i~-l~~l~lHe-~~C~r~~V~Cp~~~Cg~v~~r~el-------------------~~H~~C~~Cgk~f~-~s  466 (567)
T PLN03086        409 ECRNCKHYIP-SRSIALHE-AYCSRHNVVCPHDGCGIVLRVEEA-------------------KNHVHCEKCGQAFQ-QG  466 (567)
T ss_pred             ECCCCCCccc-hhHHHHHH-hhCCCcceeCCcccccceeecccc-------------------ccCccCCCCCCccc-hH
Confidence            5777776543 44555675 344444456663  6662222222                   23356777777775 56


Q ss_pred             HHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccC----------cHHHHHHHHHhcCCCC
Q psy13443         93 YMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQ----------GSQLMQHLRKVHKVDK  162 (188)
Q Consensus        93 ~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~----------~~~l~~H~~~~h~~~~  162 (188)
                      .|..|+..++  +++.|+ |+..+ ....|..|+.+|.+.+++.|..|+..|..          ...|..|... .+.++
T Consensus       467 ~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt  541 (567)
T PLN03086        467 EMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRT  541 (567)
T ss_pred             HHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcc
Confidence            6777777764  567777 77644 45677777777777777788888777741          2467777666 37777


Q ss_pred             CCCCcch
Q psy13443        163 KGGEEEE  169 (188)
Q Consensus       163 ~~~~~~~  169 (188)
                      +.|..|.
T Consensus       542 ~~C~~Cg  548 (567)
T PLN03086        542 APCDSCG  548 (567)
T ss_pred             eEccccC
Confidence            7776654


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.25  E-value=4.3e-11  Score=93.94  Aligned_cols=120  Identities=18%  Similarity=0.356  Sum_probs=92.0

Q ss_pred             cccCC--CcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCCCCCH
Q psy13443         14 FECDF--CPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPTR   91 (188)
Q Consensus        14 ~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~~   91 (188)
                      -.|+.  |+..|. +..+..|         +.|+.|++......+..|....            ..++.|+ |++.+ .+
T Consensus       434 V~Cp~~~Cg~v~~-r~el~~H---------~~C~~Cgk~f~~s~LekH~~~~------------Hkpv~Cp-Cg~~~-~R  489 (567)
T PLN03086        434 VVCPHDGCGIVLR-VEEAKNH---------VHCEKCGQAFQQGEMEKHMKVF------------HEPLQCP-CGVVL-EK  489 (567)
T ss_pred             eeCCcccccceee-ccccccC---------ccCCCCCCccchHHHHHHHHhc------------CCCccCC-CCCCc-ch
Confidence            35874  888873 3334444         5899999833445566665431            2578999 99755 67


Q ss_pred             HHHHHHHHhcCCCCceecccCccccC----------CchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcC
Q psy13443         92 KYMRTHIDTHNGEKPFRCALCAYSAR----------RKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus        92 ~~l~~H~~~h~~~~~~~C~~C~~~~~----------~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      ..|..|+.+|...+++.|+.|+..+.          ....|..|...+ |.+++.|..|++.+.. ..|..|+-..|.
T Consensus       490 ~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrl-rdm~~H~~~~h~  565 (567)
T PLN03086        490 EQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVML-KEMDIHQIAVHQ  565 (567)
T ss_pred             hHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeee-hhHHHHHHHhhc
Confidence            89999999999999999999999985          235899998885 8999999999999876 478899887774


No 13 
>PHA00733 hypothetical protein
Probab=99.24  E-value=6.4e-12  Score=81.14  Aligned_cols=83  Identities=19%  Similarity=0.409  Sum_probs=67.6

Q ss_pred             CceeecCCCCCCCCCHHHHHHH--HH---hcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHH
Q psy13443         76 SYTYMCYLCNYHTPTRKYMRTH--ID---THNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQL  150 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  150 (188)
                      .+++.|.+|.+.|..+..|..+  +.   .+.+.++|.|+.|++.|.+...|..|++.+  ..++.|+.|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4567788888777777666655  21   333578999999999999999999999976  4579999999999999999


Q ss_pred             HHHHHHhcCC
Q psy13443        151 MQHLRKVHKV  160 (188)
Q Consensus       151 ~~H~~~~h~~  160 (188)
                      ..|+...|+.
T Consensus       116 ~~H~~~~h~~  125 (128)
T PHA00733        116 LDHVCKKHNI  125 (128)
T ss_pred             HHHHHHhcCc
Confidence            9999998863


No 14 
>PHA00733 hypothetical protein
Probab=99.02  E-value=4.9e-10  Score=72.43  Aligned_cols=56  Identities=21%  Similarity=0.412  Sum_probs=49.6

Q ss_pred             CCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcC
Q psy13443         74 DASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTG  131 (188)
Q Consensus        74 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~  131 (188)
                      .+..+|.|+.|++.|.+...|..|++.+.  .+|.|+.|++.|.....|..|+...++
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~--~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTE--HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCC--cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34678999999999999999999999773  569999999999999999999987654


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.00  E-value=1.8e-10  Score=61.92  Aligned_cols=39  Identities=15%  Similarity=0.418  Sum_probs=19.0

Q ss_pred             eecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQG  147 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  147 (188)
                      |.|+.||+.|.....|..|+++|.  +|++|..|++.|...
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~   44 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRT   44 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccc
Confidence            445555555555555555555544  344555555544433


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=7.5e-10  Score=59.49  Aligned_cols=43  Identities=28%  Similarity=0.453  Sum_probs=39.4

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHL  122 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l  122 (188)
                      .|.|+.||+.|...+.|..|+++|+  +++.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            4899999999999999999999999  689999999999877655


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.81  E-value=1.6e-09  Score=49.89  Aligned_cols=25  Identities=28%  Similarity=0.756  Sum_probs=22.7

Q ss_pred             ChhHHhhccCCCccccCCCcccccC
Q psy13443          1 MLRHVRTHLAKQQFECDFCPYGAKQ   25 (188)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~   25 (188)
                      |..|+++|++++||.|+.|+++|..
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            5789999999999999999999863


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.80  E-value=3.5e-09  Score=48.74  Aligned_cols=24  Identities=54%  Similarity=0.989  Sum_probs=15.4

Q ss_pred             HHHHHHhhcCCCCccCCCCccccc
Q psy13443        122 LDDHMRRHTGEKPHACGMCGYECA  145 (188)
Q Consensus       122 l~~H~~~h~~~~~~~C~~C~~~f~  145 (188)
                      |..|+++|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            556666666666666666666664


No 19 
>PHA00616 hypothetical protein
Probab=98.65  E-value=1.4e-08  Score=51.98  Aligned_cols=33  Identities=30%  Similarity=0.397  Sum_probs=24.7

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhcCCCCCCCC
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVHKVDKKGGE  166 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~  166 (188)
                      ||+|+.||+.|...+.|..|++.+|+.+++.++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            577777777777777777777777777776654


No 20 
>KOG3993|consensus
Probab=98.54  E-value=2.5e-08  Score=74.63  Aligned_cols=86  Identities=19%  Similarity=0.236  Sum_probs=57.8

Q ss_pred             CceeecCCCCCCCCCHHHHHHHHHhcCCCC----------------------------------------------ceec
Q psy13443         76 SYTYMCYLCNYHTPTRKYMRTHIDTHNGEK----------------------------------------------PFRC  109 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----------------------------------------------~~~C  109 (188)
                      +.-|.|..|++.|+....|..|+.+|...-                                              ...+
T Consensus       354 ~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~p  433 (500)
T KOG3993|consen  354 SGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELP  433 (500)
T ss_pred             CceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCC
Confidence            346999999999999999999987765320                                              0123


Q ss_pred             ccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcCCC
Q psy13443        110 ALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHKVD  161 (188)
Q Consensus       110 ~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  161 (188)
                      +.++..+.++..--.+.+.-.....|.|.+|.-+|.+...|.+|+...|..+
T Consensus       434 p~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse  485 (500)
T KOG3993|consen  434 PYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSE  485 (500)
T ss_pred             CCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChHH
Confidence            3444444333332222222222344889999999999999999998888543


No 21 
>KOG3993|consensus
Probab=98.50  E-value=1.8e-08  Score=75.40  Aligned_cols=86  Identities=20%  Similarity=0.339  Sum_probs=65.7

Q ss_pred             eecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcC---------------------------
Q psy13443         79 YMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTG---------------------------  131 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~---------------------------  131 (188)
                      |.|.+|...|.....|.+|.-.--...-|+|+.|++.|+..++|..|.|.|..                           
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            78888888888888888886321111238888888888888888888887741                           


Q ss_pred             ------CCCccCCCCcccccCcHHHHHHHHHhcCCCCCC
Q psy13443        132 ------EKPHACGMCGYECAQGSQLMQHLRKVHKVDKKG  164 (188)
Q Consensus       132 ------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  164 (188)
                            +.-|.|.+|++.|.....|.+|+-+|+.....+
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k  386 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAK  386 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccch
Confidence                  123899999999999999999999998654433


No 22 
>PHA00616 hypothetical protein
Probab=98.50  E-value=4.3e-08  Score=50.19  Aligned_cols=33  Identities=15%  Similarity=0.275  Sum_probs=21.5

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHhcCCCCceecc
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCA  110 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  110 (188)
                      ||+|+.||+.|...+.|..|++.|++++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            356666666666666666666666666666554


No 23 
>PHA00732 hypothetical protein
Probab=98.37  E-value=2.4e-07  Score=54.49  Aligned_cols=46  Identities=26%  Similarity=0.604  Sum_probs=34.1

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHh-cCCCCceecccCccccCCchhHHHHHHhh
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDT-HNGEKPFRCALCAYSARRKTHLDDHMRRH  129 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~~~~~~~l~~H~~~h  129 (188)
                      ||.|..|++.|.+...|..|++. |.   ++.|+.|++.|.   .+..|..++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            47788888888888888888874 44   357888888887   356676554


No 24 
>PHA00732 hypothetical protein
Probab=98.25  E-value=1.1e-06  Score=51.81  Aligned_cols=47  Identities=30%  Similarity=0.627  Sum_probs=39.3

Q ss_pred             ceecccCccccCCchhHHHHHHh-hcCCCCccCCCCcccccCcHHHHHHHHHhc
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRR-HTGEKPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      ||.|..|++.|.+...|..|++. |.   ++.|+.|++.|.   .|..|.+++-
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            58899999999999999999985 54   368999999997   4788885543


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.15  E-value=4.9e-06  Score=45.47  Aligned_cols=49  Identities=27%  Similarity=0.622  Sum_probs=20.9

Q ss_pred             eecccCccccCCchhHHHHHHh-hcC-CCCccCCCCcccccCcHHHHHHHHHhc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRR-HTG-EKPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~-h~~-~~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      |.||.|++ ..+...|..|... |.. .+.+.|++|...+.  ..|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            44555554 2333444444433 222 12345555554322  24555555444


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.14  E-value=6e-06  Score=45.11  Aligned_cols=50  Identities=18%  Similarity=0.472  Sum_probs=38.7

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHh-cCC-CCceecccCccccCCchhHHHHHHhhc
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDT-HNG-EKPFRCALCAYSARRKTHLDDHMRRHT  130 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~C~~~~~~~~~l~~H~~~h~  130 (188)
                      .|.|+.|++. .+...|..|... |.. .+.+.||+|...+.  .+|..|+...+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            4789999994 557789999774 443 35799999998655  48899988765


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.00  E-value=4.1e-06  Score=37.18  Aligned_cols=22  Identities=32%  Similarity=0.736  Sum_probs=15.2

Q ss_pred             ccCCCCcccccCcHHHHHHHHH
Q psy13443        135 HACGMCGYECAQGSQLMQHLRK  156 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (188)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4567777777777777777665


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.00  E-value=5e-06  Score=37.17  Aligned_cols=24  Identities=38%  Similarity=0.729  Sum_probs=17.3

Q ss_pred             ccCCCCcccccCcHHHHHHHHHhc
Q psy13443        135 HACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            568888888888888888887765


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.95  E-value=5.4e-06  Score=36.80  Aligned_cols=22  Identities=18%  Similarity=0.631  Sum_probs=12.5

Q ss_pred             eecCCCCCCCCCHHHHHHHHHh
Q psy13443         79 YMCYLCNYHTPTRKYMRTHIDT  100 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (188)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4555555555555555555554


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.90  E-value=7.7e-06  Score=50.64  Aligned_cols=73  Identities=15%  Similarity=0.309  Sum_probs=21.8

Q ss_pred             ecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHh
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKV  157 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  157 (188)
                      +|..|+..|.+...|..|+...++-..   + ....+.....+..+.+... ...+.|..|+..|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc---c-ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            489999999999999999975554321   1 1112223334444443322 23689999999999999999999875


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.79  E-value=5.9e-06  Score=60.10  Aligned_cols=52  Identities=25%  Similarity=0.547  Sum_probs=42.2

Q ss_pred             CCceeccc--CccccCCchhHHHHHHhhc-------------------CCCCccCCCCcccccCcHHHHHHHH
Q psy13443        104 EKPFRCAL--CAYSARRKTHLDDHMRRHT-------------------GEKPHACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus       104 ~~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  155 (188)
                      +|||.|++  |.+.|.....|..|+..-+                   ..+||+|.+|++.++.-..|+.|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            37888877  8888888888888876422                   3589999999999999999998864


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.75  E-value=2.8e-05  Score=34.61  Aligned_cols=24  Identities=21%  Similarity=0.677  Sum_probs=19.5

Q ss_pred             cccCCCcccccCHHHHHHHHHhhh
Q psy13443         14 FECDFCPYGAKQAADVHNHVQQIH   37 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~~~~~   37 (188)
                      |.|++|++.|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999996553


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.74  E-value=1.3e-05  Score=37.07  Aligned_cols=25  Identities=32%  Similarity=0.541  Sum_probs=14.1

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhc
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      ||.|..|++.|.+...|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3555556666666666666655443


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.68  E-value=2.8e-05  Score=35.90  Aligned_cols=25  Identities=24%  Similarity=0.438  Sum_probs=22.0

Q ss_pred             ccccCCCcccccCHHHHHHHHHhhh
Q psy13443         13 QFECDFCPYGAKQAADVHNHVQQIH   37 (188)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~H~~~~~   37 (188)
                      ||.|..|++.|.+...|..|++.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999985443


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.55  E-value=6.8e-05  Score=46.31  Aligned_cols=73  Identities=16%  Similarity=0.243  Sum_probs=16.3

Q ss_pred             ccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCCCCCHHHH
Q psy13443         15 ECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTPTRKYM   94 (188)
Q Consensus        15 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~~l   94 (188)
                      .|..|+..|.+...|..|+...|+-..   +....+.....+......           .....+.|..|++.|.+...|
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~~~~~l~~~~~~~~~~~~-----------~~~~~~~C~~C~~~f~s~~~l   66 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---PDQKYLVDPNRLLNYLRK-----------KVKESFRCPYCNKTFRSREAL   66 (100)
T ss_dssp             --------------------------------------------------------------SSEEBSSSS-EESSHHHH
T ss_pred             Ccccccccccccccccccccccccccc---cccccccccccccccccc-----------ccCCCCCCCccCCCCcCHHHH
Confidence            489999999999999999977775321   100011111111111100           111246677777777777777


Q ss_pred             HHHHHhc
Q psy13443         95 RTHIDTH  101 (188)
Q Consensus        95 ~~H~~~h  101 (188)
                      ..|++.+
T Consensus        67 ~~Hm~~~   73 (100)
T PF12756_consen   67 QEHMRSK   73 (100)
T ss_dssp             HHHHHHT
T ss_pred             HHHHcCc
Confidence            7777654


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.36  E-value=0.00021  Score=37.54  Aligned_cols=31  Identities=32%  Similarity=0.558  Sum_probs=17.6

Q ss_pred             CCCccCCCCcccccCcHHHHHHHHHhcCCCC
Q psy13443        132 EKPHACGMCGYECAQGSQLMQHLRKVHKVDK  162 (188)
Q Consensus       132 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  162 (188)
                      +.|-.|++|+..+.+..+|.+|++..|+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4556777777777777777777777776654


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.32  E-value=0.00019  Score=32.05  Aligned_cols=24  Identities=33%  Similarity=0.711  Sum_probs=16.2

Q ss_pred             ccCCCCcccccCcHHHHHHHHHhcC
Q psy13443        135 HACGMCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      |+|+.|++... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777877776 7778888777764


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.23  E-value=0.0001  Score=53.82  Aligned_cols=52  Identities=23%  Similarity=0.537  Sum_probs=43.7

Q ss_pred             CceeecCC--CCCCCCCHHHHHHHHHhcC-------------------CCCceecccCccccCCchhHHHHHH
Q psy13443         76 SYTYMCYL--CNYHTPTRKYMRTHIDTHN-------------------GEKPFRCALCAYSARRKTHLDDHMR  127 (188)
Q Consensus        76 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~~~~~~~l~~H~~  127 (188)
                      .+||.|++  |++.+.....|+-|+.--+                   ..|||+|++|++.|.....|..|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48999976  9999999999999985322                   1279999999999999999988864


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.21  E-value=0.00036  Score=31.40  Aligned_cols=23  Identities=30%  Similarity=0.508  Sum_probs=19.2

Q ss_pred             ccCCCCcccccCcHHHHHHHHHh
Q psy13443        135 HACGMCGYECAQGSQLMQHLRKV  157 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~~  157 (188)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57888999999999999998744


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.17  E-value=0.00048  Score=36.23  Aligned_cols=37  Identities=16%  Similarity=0.337  Sum_probs=24.5

Q ss_pred             HhhccC-CCccccCCCcccccCHHHHHHHHHhhhcCCc
Q psy13443          5 VRTHLA-KQQFECDFCPYGAKQAADVHNHVQQIHMGVN   41 (188)
Q Consensus         5 ~~~h~~-~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~   41 (188)
                      .+++.. +.|-.|++|+..+....+|.+|+...|..+|
T Consensus        15 ~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   15 PKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             -CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             HHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            333433 5689999999999999999999988887654


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.05  E-value=0.00067  Score=30.45  Aligned_cols=22  Identities=23%  Similarity=0.502  Sum_probs=14.0

Q ss_pred             ecCCCCCCCCCHHHHHHHHHhc
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTH  101 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h  101 (188)
                      .|..|++.|.....|..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4666666666666666666644


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.98  E-value=0.00086  Score=29.83  Aligned_cols=24  Identities=21%  Similarity=0.772  Sum_probs=19.0

Q ss_pred             cccCCCcccccCHHHHHHHHHhhhc
Q psy13443         14 FECDFCPYGAKQAADVHNHVQQIHM   38 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~~~~~~   38 (188)
                      |.|+.|+.... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999988 9999999977663


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.92  E-value=0.00078  Score=45.33  Aligned_cols=37  Identities=30%  Similarity=0.617  Sum_probs=22.3

Q ss_pred             ceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccC
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQ  146 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  146 (188)
                      +|.|. |+.   ....+..|.+++.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            46665 655   44555666666666666666666665543


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.85  E-value=0.00083  Score=30.16  Aligned_cols=21  Identities=24%  Similarity=0.651  Sum_probs=19.6

Q ss_pred             cccCCCcccccCHHHHHHHHH
Q psy13443         14 FECDFCPYGAKQAADVHNHVQ   34 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~~   34 (188)
                      |.|.+|++.|.+...|..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            689999999999999999984


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.82  E-value=0.00072  Score=30.38  Aligned_cols=21  Identities=24%  Similarity=0.705  Sum_probs=12.2

Q ss_pred             eecCCCCCCCCCHHHHHHHHH
Q psy13443         79 YMCYLCNYHTPTRKYMRTHID   99 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~   99 (188)
                      |.|.+|+..|.+...|.+|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345666666666666666654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.67  E-value=0.0014  Score=44.04  Aligned_cols=41  Identities=27%  Similarity=0.563  Sum_probs=35.1

Q ss_pred             CceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCch
Q psy13443         76 SYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKT  120 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~  120 (188)
                      ..+|.|. |+.   ....+..|.++++++++|.|..|+..|....
T Consensus       117 ~~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        117 TFPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            3579998 997   6678899999999999999999999887543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.83  E-value=0.002  Score=29.59  Aligned_cols=21  Identities=29%  Similarity=0.564  Sum_probs=14.0

Q ss_pred             ccCCCCcccccCcHHHHHHHH
Q psy13443        135 HACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~  155 (188)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456677777777777766654


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.73  E-value=0.0033  Score=28.80  Aligned_cols=22  Identities=14%  Similarity=0.561  Sum_probs=15.1

Q ss_pred             eecCCCCCCCCCHHHHHHHHHh
Q psy13443         79 YMCYLCNYHTPTRKYMRTHIDT  100 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (188)
                      |.|..|++.|.+...+.+|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5577777777777777776653


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.44  E-value=0.017  Score=25.96  Aligned_cols=21  Identities=24%  Similarity=0.569  Sum_probs=14.5

Q ss_pred             ccCCCCcccccCcHHHHHHHHH
Q psy13443        135 HACGMCGYECAQGSQLMQHLRK  156 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (188)
                      ..|+.|++.| ....|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4677788887 55677777653


No 50 
>KOG1146|consensus
Probab=95.30  E-value=0.0033  Score=54.47  Aligned_cols=81  Identities=23%  Similarity=0.374  Sum_probs=53.6

Q ss_pred             ccCCCccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCC
Q psy13443          8 HLAKQQFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYH   87 (188)
Q Consensus         8 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~   87 (188)
                      ++..+.|+|+.|+..|+....|..|++..|.+-.-  ..|..      ...    ++..-+..+...+-++|.|..|..+
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~------gq~----~~~~arg~~~~~~~~p~~C~~C~~s  527 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKA------GQN----HPRLARGEVYRCPGKPYPCRACNYS  527 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccch--hHhHh------ccc----cccccccccccCCCCcccceeeeee
Confidence            45557899999999999999999999766643221  22211      000    1111111222245578999999999


Q ss_pred             CCCHHHHHHHHHh
Q psy13443         88 TPTRKYMRTHIDT  100 (188)
Q Consensus        88 f~~~~~l~~H~~~  100 (188)
                      +.....|..|+.+
T Consensus       528 tttng~LsihlqS  540 (1406)
T KOG1146|consen  528 TTTNGNLSIHLQS  540 (1406)
T ss_pred             eecchHHHHHHHH
Confidence            9999999999863


No 51 
>KOG2231|consensus
Probab=95.17  E-value=0.044  Score=44.93  Aligned_cols=103  Identities=18%  Similarity=0.335  Sum_probs=61.9

Q ss_pred             cCCCcccccCHHHHHHHHHhhhcCCcccCCCCCC----ccc------ccccccccccccccccccccCCCCceeecCCCC
Q psy13443         16 CDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQ----FEV------VPTRKTQTLEHCATCVDMVRPDASYTYMCYLCN   85 (188)
Q Consensus        16 C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~----~~~------~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~   85 (188)
                      |.+| ..|.....|..|+...|..  +.|..|-.    |+.      ...++.|+..-++ +...+.  +  --.|..|.
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~-d~~s~r--G--hp~C~~C~  189 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP-DDESCR--G--HPLCKFCH  189 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHHHHHHHHhcCCC-cccccc--C--Cccchhhh
Confidence            4444 4445889999999666643  56777732    322      2223333332222 111111  1  24688899


Q ss_pred             CCCCCHHHHHHHHHhcCCCCceecccC------ccccCCchhHHHHHHhhc
Q psy13443         86 YHTPTRKYMRTHIDTHNGEKPFRCALC------AYSARRKTHLDDHMRRHT  130 (188)
Q Consensus        86 ~~f~~~~~l~~H~~~h~~~~~~~C~~C------~~~~~~~~~l~~H~~~h~  130 (188)
                      ..|.....|..|++.++    |.|..|      +..|.....|..|.+.++
T Consensus       190 ~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  190 ERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            99999999999988765    555555      345677788888877654


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.94  E-value=0.026  Score=27.38  Aligned_cols=23  Identities=22%  Similarity=0.521  Sum_probs=20.5

Q ss_pred             CccccCCCcccccCHHHHHHHHH
Q psy13443         12 QQFECDFCPYGAKQAADVHNHVQ   34 (188)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~H~~   34 (188)
                      .+|.|..|+..|.+...+..|++
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHC
Confidence            36899999999999999999984


No 53 
>KOG1146|consensus
Probab=94.80  E-value=0.011  Score=51.31  Aligned_cols=56  Identities=29%  Similarity=0.564  Sum_probs=43.6

Q ss_pred             cCCCCceecccCccccCCchhHHHHHHhhc-------------------------CCCCccCCCCcccccCcHHHHHHHH
Q psy13443        101 HNGEKPFRCALCAYSARRKTHLDDHMRRHT-------------------------GEKPHACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus       101 h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~-------------------------~~~~~~C~~C~~~f~~~~~l~~H~~  155 (188)
                      +...+.+.|+.|+..|.....|..|+|..+                         +.++|.|..|...+.....|..|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            334466778888888888777777777621                         3467999999999999999999986


Q ss_pred             H
Q psy13443        156 K  156 (188)
Q Consensus       156 ~  156 (188)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            4


No 54 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.72  E-value=0.095  Score=39.35  Aligned_cols=134  Identities=19%  Similarity=0.363  Sum_probs=83.0

Q ss_pred             ccccCC--CcccccCHHHHHHHHHhhhcCCcccCCCCC--C--ccc------ccccccccccccccccccccCCCCceee
Q psy13443         13 QFECDF--CPYGAKQAADVHNHVQQIHMGVNFVCVHCK--Q--FEV------VPTRKTQTLEHCATCVDMVRPDASYTYM   80 (188)
Q Consensus        13 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~--~--~~~------~~~~~~~~~~~c~~c~~~~~~~~~~~~~   80 (188)
                      .|.|+.  |..+...+..|+.|....|.  .+.|..|-  +  |..      ...++.|...-  .-+.+|    +.--.
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G--~~e~GF----KGHP~  222 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGG--LEEEGF----KGHPL  222 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCC--ccccCc----CCCch
Confidence            367764  77777778899999865554  36788882  2  332      23333333210  000011    11236


Q ss_pred             cCCCCCCCCCHHHHHHHHHhcCCCCceecccCc----cccCCchhHHHHHHhhcCCCCccCCC--Cc----ccccCcHHH
Q psy13443         81 CYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCA----YSARRKTHLDDHMRRHTGEKPHACGM--CG----YECAQGSQL  150 (188)
Q Consensus        81 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~----~~~~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l  150 (188)
                      |..|...|.+...|..|.+.-+. +-|.|..-+    .-|.+..+|..|.+.-    -|.|..  |.    ..|.....|
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~~~----hy~ct~qtc~~~k~~vf~~~~el  297 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFRNA----HYCCTFQTCRVGKCYVFPYHTEL  297 (493)
T ss_pred             hhhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhhcC----ceEEEEEEEecCcEEEeccHHHH
Confidence            99999999999999999985442 234443322    3367777888776542    356543  32    568899999


Q ss_pred             HHHHHHhcC
Q psy13443        151 MQHLRKVHK  159 (188)
Q Consensus       151 ~~H~~~~h~  159 (188)
                      ..|+-..|+
T Consensus       298 ~~h~~~~h~  306 (493)
T COG5236         298 LEHLTRFHK  306 (493)
T ss_pred             HHHHHHHhh
Confidence            999988885


No 55 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.62  E-value=0.088  Score=33.11  Aligned_cols=83  Identities=18%  Similarity=0.300  Sum_probs=47.0

Q ss_pred             CceeecCCCCCCCCCHHHHHHHHHhcCCCC-ceecccCccccCCchhH-HH--HHHh-hcC---------CCCccC----
Q psy13443         76 SYTYMCYLCNYHTPTRKYMRTHIDTHNGEK-PFRCALCAYSARRKTHL-DD--HMRR-HTG---------EKPHAC----  137 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~~C~~C~~~~~~~~~l-~~--H~~~-h~~---------~~~~~C----  137 (188)
                      -+...|..|..+... +.+..|++..+... ...-..-...+.....+ ..  .... ..+         -..|.|    
T Consensus         9 ~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~   87 (109)
T PF12013_consen    9 YRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDP   87 (109)
T ss_pred             CCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCC
Confidence            345789999988776 88999998443221 11000000000000000 00  0000 000         122899    


Q ss_pred             CCCcccccCcHHHHHHHHHhcC
Q psy13443        138 GMCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus       138 ~~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      ..|++.+.+...|.+|++.+|+
T Consensus        88 ~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   88 PHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCcEeccHHHHHHHHHHhcC
Confidence            9999999999999999999885


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.56  E-value=0.016  Score=31.04  Aligned_cols=34  Identities=24%  Similarity=0.372  Sum_probs=29.0

Q ss_pred             HhhccCCCccccCCCcccccCHHHHHHHHHhhhc
Q psy13443          5 VRTHLAKQQFECDFCPYGAKQAADVHNHVQQIHM   38 (188)
Q Consensus         5 ~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   38 (188)
                      +++.-|+..+.|+-|+..|.+..+..+|....|+
T Consensus         9 v~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049           9 VRDRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             eeccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3455678889999999999999999999987775


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.56  E-value=0.031  Score=26.94  Aligned_cols=24  Identities=29%  Similarity=0.919  Sum_probs=13.0

Q ss_pred             eecccCccccCCchhHHHHHHhhcCCCCccCCCCcc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGY  142 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  142 (188)
                      |.|.+||..+....            .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            45666665554322            4556666654


No 58 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.53  E-value=0.078  Score=33.29  Aligned_cols=24  Identities=21%  Similarity=0.314  Sum_probs=14.5

Q ss_pred             ceecccCccccCCchhHHHHHHhh
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRRH  129 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~h  129 (188)
                      .|+|+.|...|-..=++-.|..+|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            466666666666655555555555


No 59 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=94.38  E-value=0.062  Score=29.34  Aligned_cols=46  Identities=20%  Similarity=0.507  Sum_probs=23.0

Q ss_pred             cccccccc-cCCCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCcc
Q psy13443         64 CATCVDMV-RPDASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAY  114 (188)
Q Consensus        64 c~~c~~~~-~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  114 (188)
                      |..|+..+ .......|.|+.||.....+...-   +.  ...+|+|+.||+
T Consensus        12 CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~~C---Rk--~g~~Y~Cp~CGF   58 (61)
T COG2888          12 CTSCGREIAPGETAVKFPCPNCGEVEIYRCAKC---RK--LGNPYRCPKCGF   58 (61)
T ss_pred             eccCCCEeccCCceeEeeCCCCCceeeehhhhH---HH--cCCceECCCcCc
Confidence            33444444 223344577888886554433211   11  124677777774


No 60 
>KOG2785|consensus
Probab=94.36  E-value=0.17  Score=38.54  Aligned_cols=57  Identities=18%  Similarity=0.248  Sum_probs=44.0

Q ss_pred             eecccCccccCCchhHHHHHHhhcCC-----------------------CCccCCCCc---ccccCcHHHHHHHHH-hcC
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGE-----------------------KPHACGMCG---YECAQGSQLMQHLRK-VHK  159 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~-~h~  159 (188)
                      -.|..|+..+.+......||..++|-                       .-+.|-.|.   +.|.+-...+.|+.. -|.
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K~HC  246 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDKGHC  246 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhccCc
Confidence            45788999999999999999877641                       226788888   999999999999964 444


Q ss_pred             CCCC
Q psy13443        160 VDKK  163 (188)
Q Consensus       160 ~~~~  163 (188)
                      .-+|
T Consensus       247 kl~y  250 (390)
T KOG2785|consen  247 KLPY  250 (390)
T ss_pred             ccCC
Confidence            4444


No 61 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.30  E-value=0.048  Score=26.41  Aligned_cols=22  Identities=23%  Similarity=0.566  Sum_probs=17.2

Q ss_pred             eeecCCCCCCCCCHHHHHHHHH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHID   99 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~   99 (188)
                      +|.|.+|+..|.+...+.+|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4678888888888888888875


No 62 
>KOG2482|consensus
Probab=94.06  E-value=0.084  Score=39.52  Aligned_cols=49  Identities=20%  Similarity=0.396  Sum_probs=35.4

Q ss_pred             eecccCccccCCchhHHHHHHhhcC---------------------------CCCccCCCCcccccCcHHHHHHHH
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTG---------------------------EKPHACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~  155 (188)
                      ..|-.|...+.+...|..||.+-+.                           .....|..|.-.|-.+..|..|+.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcc
Confidence            3677788888888888888875331                           112467788888888888888874


No 63 
>KOG4173|consensus
Probab=94.00  E-value=0.037  Score=38.33  Aligned_cols=79  Identities=20%  Similarity=0.391  Sum_probs=59.5

Q ss_pred             eeecCC--CCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhc----------CCCCccCC--CCccc
Q psy13443         78 TYMCYL--CNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHT----------GEKPHACG--MCGYE  143 (188)
Q Consensus        78 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~----------~~~~~~C~--~C~~~  143 (188)
                      .|.|++  |-+.|.....+..|..+-++   ..|..|.+.|.+...|..|+...+          |...|+|-  .|+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            466766  66677777777777765443   379999999999988888886543          33458885  49999


Q ss_pred             ccCcHHHHHHHHHhcC
Q psy13443        144 CAQGSQLMQHLRKVHK  159 (188)
Q Consensus       144 f~~~~~l~~H~~~~h~  159 (188)
                      |.+..+-..|+-..|+
T Consensus       156 FkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhHHHHhcc
Confidence            9999999999877774


No 64 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.97  E-value=0.028  Score=30.12  Aligned_cols=30  Identities=27%  Similarity=0.524  Sum_probs=24.6

Q ss_pred             CCCCccCCCCcccccCcHHHHHHHHHhcCC
Q psy13443        131 GEKPHACGMCGYECAQGSQLMQHLRKVHKV  160 (188)
Q Consensus       131 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  160 (188)
                      |+..++|+.|+..|....+..+|+...|+.
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            566688999999999988888998877753


No 65 
>KOG2893|consensus
Probab=93.32  E-value=0.032  Score=39.57  Aligned_cols=42  Identities=24%  Similarity=0.518  Sum_probs=31.3

Q ss_pred             ecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHH
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDH  125 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H  125 (188)
                      .|+.|++.|.....|.+|++..    .|.|.+|-+.+.+-..|..|
T Consensus        12 wcwycnrefddekiliqhqkak----hfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAK----HFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhhc----cceeeeehhhhccCCCceee
Confidence            4788888888888888887653    37888888777666666665


No 66 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=92.77  E-value=0.15  Score=27.89  Aligned_cols=12  Identities=17%  Similarity=0.573  Sum_probs=7.7

Q ss_pred             CceeecCCCCCC
Q psy13443         76 SYTYMCYLCNYH   87 (188)
Q Consensus        76 ~~~~~C~~C~~~   87 (188)
                      ...|.|+.||..
T Consensus        23 ~~~F~CPnCG~~   34 (59)
T PRK14890         23 AVKFLCPNCGEV   34 (59)
T ss_pred             cCEeeCCCCCCe
Confidence            345777777765


No 67 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=91.55  E-value=0.062  Score=38.65  Aligned_cols=27  Identities=30%  Similarity=0.655  Sum_probs=19.1

Q ss_pred             CCCceecccCccccCCchhHHHHHHhh
Q psy13443        103 GEKPFRCALCAYSARRKTHLDDHMRRH  129 (188)
Q Consensus       103 ~~~~~~C~~C~~~~~~~~~l~~H~~~h  129 (188)
                      ..+++.||.|+........|.--.++|
T Consensus       206 k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  206 KGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             cCCCCCCCCCCCcccccccceeeeecc
Confidence            446888999998877766665555554


No 68 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.37  E-value=0.17  Score=24.51  Aligned_cols=11  Identities=27%  Similarity=0.993  Sum_probs=6.3

Q ss_pred             eecccCccccC
Q psy13443        107 FRCALCAYSAR  117 (188)
Q Consensus       107 ~~C~~C~~~~~  117 (188)
                      |.|.+||..+.
T Consensus         3 ~~C~~CG~i~~   13 (34)
T cd00729           3 WVCPVCGYIHE   13 (34)
T ss_pred             EECCCCCCEeE
Confidence            56666665543


No 69 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.16  E-value=0.8  Score=28.74  Aligned_cols=25  Identities=36%  Similarity=0.905  Sum_probs=20.2

Q ss_pred             eec----ccCccccCCchhHHHHHHhhcC
Q psy13443        107 FRC----ALCAYSARRKTHLDDHMRRHTG  131 (188)
Q Consensus       107 ~~C----~~C~~~~~~~~~l~~H~~~h~~  131 (188)
                      |.|    ..|++...+...+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8888888888888888877653


No 70 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.61  E-value=0.051  Score=42.37  Aligned_cols=65  Identities=26%  Similarity=0.534  Sum_probs=54.7

Q ss_pred             ceecccCccccCCchhHHHHHH--hhcCC--CCccCC--CCcccccCcHHHHHHHHHhcCCCCCCCCcchh
Q psy13443        106 PFRCALCAYSARRKTHLDDHMR--RHTGE--KPHACG--MCGYECAQGSQLMQHLRKVHKVDKKGGEEEEE  170 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~  170 (188)
                      ++.|..|...|.....+..|.+  .|.++  +|+.|+  .|++.|.....+..|...+.+..+..+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  359 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNS  359 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccC
Confidence            5778889999999999999999  78888  899999  79999999999999998888877766654444


No 71 
>KOG2893|consensus
Probab=90.30  E-value=0.06  Score=38.21  Aligned_cols=48  Identities=25%  Similarity=0.425  Sum_probs=37.7

Q ss_pred             ecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcC
Q psy13443        108 RCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus       108 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      =|..|++.|....-|..|++..    -|+|-+|.+..-+--.|..|--.+|+
T Consensus        12 wcwycnrefddekiliqhqkak----hfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAK----HFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccchhhhhhhhhhhc----cceeeeehhhhccCCCceeehhhhhh
Confidence            3778999999999999887653    48999999887776677777655554


No 72 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=89.90  E-value=0.34  Score=21.43  Aligned_cols=10  Identities=20%  Similarity=0.670  Sum_probs=5.9

Q ss_pred             CceeecCCCC
Q psy13443         76 SYTYMCYLCN   85 (188)
Q Consensus        76 ~~~~~C~~C~   85 (188)
                      ...|.|+.||
T Consensus        14 ~v~f~CPnCG   23 (24)
T PF07754_consen   14 AVPFPCPNCG   23 (24)
T ss_pred             CceEeCCCCC
Confidence            3456666665


No 73 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.34  E-value=0.37  Score=23.81  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=6.4

Q ss_pred             ecccCccccCCch
Q psy13443        108 RCALCAYSARRKT  120 (188)
Q Consensus       108 ~C~~C~~~~~~~~  120 (188)
                      .|+.|+..|.-..
T Consensus         4 ~CP~C~~~f~v~~   16 (37)
T PF13719_consen    4 TCPNCQTRFRVPD   16 (37)
T ss_pred             ECCCCCceEEcCH
Confidence            4555555554443


No 74 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.19  E-value=0.093  Score=40.93  Aligned_cols=63  Identities=29%  Similarity=0.504  Sum_probs=56.8

Q ss_pred             ceeecCCCCCCCCCHHHHHHHHH--hcCCC--Cceecc--cCccccCCchhHHHHHHhhcCCCCccCCC
Q psy13443         77 YTYMCYLCNYHTPTRKYMRTHID--THNGE--KPFRCA--LCAYSARRKTHLDDHMRRHTGEKPHACGM  139 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~~~~~~~l~~H~~~h~~~~~~~C~~  139 (188)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|+..|.+...+..|...|.+..++.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            46889999999999999999999  89999  999999  79999999999999999998877766644


No 75 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=88.62  E-value=0.36  Score=21.84  Aligned_cols=10  Identities=30%  Similarity=0.849  Sum_probs=5.6

Q ss_pred             ecCCCCCCCC
Q psy13443         80 MCYLCNYHTP   89 (188)
Q Consensus        80 ~C~~C~~~f~   89 (188)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666666553


No 76 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.39  E-value=0.65  Score=31.51  Aligned_cols=25  Identities=40%  Similarity=1.108  Sum_probs=19.1

Q ss_pred             CceecccCccccCCchhHHHHHHhhcCCCCccCCCCcc
Q psy13443        105 KPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGY  142 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  142 (188)
                      +.|.|++||..+             .++.|-+||+|+.
T Consensus       133 ~~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            369999998653             3467889999984


No 77 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.37  E-value=0.4  Score=24.74  Aligned_cols=26  Identities=27%  Similarity=0.714  Sum_probs=14.0

Q ss_pred             eecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      |.|..||..|...           ...+.+|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            5666666655433           1344566666643


No 78 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.09  E-value=1.7  Score=27.40  Aligned_cols=82  Identities=17%  Similarity=0.275  Sum_probs=50.7

Q ss_pred             CCccccCCCcccccCHHHHHHHHHhhhcC--CcccCCCCCCcccccccccccccccccccccccC---------CCCcee
Q psy13443         11 KQQFECDFCPYGAKQAADVHNHVQQIHMG--VNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRP---------DASYTY   79 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~--~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~---------~~~~~~   79 (188)
                      +-|-.|+.|+-+......|.+..  +|.-  .+|.=-        ..........|-.|...|..         .....|
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev--------~~~~~~~~~~C~~C~~~f~~~~~~~~~~~~~~~~y   82 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSY--HHLFPLKAFQEI--------PLEEYNGSRFCFGCQGPFPKPPVSPFDELKDSHRY   82 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhh--hccCCCcccccc--------cccccCCCCcccCcCCCCCCcccccccccccccce
Confidence            45788999999998899998874  4421  112100        00000011234455444432         234469


Q ss_pred             ecCCCCCCCCCHHHHHHHHHhcC
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTHN  102 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h~  102 (188)
                      .|+.|...|-..-++..|...|.
T Consensus        83 ~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        83 VCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             eCCCCCCccccccchhhhhhccC
Confidence            99999999998888888887775


No 79 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=87.69  E-value=0.65  Score=22.78  Aligned_cols=13  Identities=15%  Similarity=0.363  Sum_probs=6.4

Q ss_pred             ecccCccccCCch
Q psy13443        108 RCALCAYSARRKT  120 (188)
Q Consensus       108 ~C~~C~~~~~~~~  120 (188)
                      .|+.|+..|.-..
T Consensus         4 ~Cp~C~~~y~i~d   16 (36)
T PF13717_consen    4 TCPNCQAKYEIDD   16 (36)
T ss_pred             ECCCCCCEEeCCH
Confidence            4555555554443


No 80 
>KOG2186|consensus
Probab=86.99  E-value=0.49  Score=34.08  Aligned_cols=47  Identities=17%  Similarity=0.463  Sum_probs=29.8

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMR  127 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~  127 (188)
                      .|.|..||....-+ .+..|+..-++ ..|.|..|+..|.. ..+..|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            36677777666543 45557666555 45777777777776 55556654


No 81 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=86.82  E-value=0.59  Score=23.06  Aligned_cols=10  Identities=40%  Similarity=0.902  Sum_probs=4.4

Q ss_pred             ccCCCCcccc
Q psy13443        135 HACGMCGYEC  144 (188)
Q Consensus       135 ~~C~~C~~~f  144 (188)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            3444444443


No 82 
>KOG2482|consensus
Probab=86.45  E-value=1.2  Score=33.60  Aligned_cols=51  Identities=25%  Similarity=0.461  Sum_probs=40.1

Q ss_pred             eecCCCCCCCCCHHHHHHHHHh-cCCC--------------------------CceecccCccccCCchhHHHHHHhh
Q psy13443         79 YMCYLCNYHTPTRKYMRTHIDT-HNGE--------------------------KPFRCALCAYSARRKTHLDDHMRRH  129 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~-h~~~--------------------------~~~~C~~C~~~~~~~~~l~~H~~~h  129 (188)
                      ..|-.|....-....+..|+.. |.-.                          +...|..|.-.|-....|..|+..+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            5899999888889999999863 3211                          2357888999999999999998754


No 83 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=86.26  E-value=1.3  Score=31.98  Aligned_cols=51  Identities=16%  Similarity=0.371  Sum_probs=33.1

Q ss_pred             ccCCCCCCcccccccccccccccccccccccC------CCCceeecCCCCCCCCCHH
Q psy13443         42 FVCVHCKQFEVVPTRKTQTLEHCATCVDMVRP------DASYTYMCYLCNYHTPTRK   92 (188)
Q Consensus        42 ~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~------~~~~~~~C~~C~~~f~~~~   92 (188)
                      |-|..|+......--.......|..|.+.+.+      .|-..|.|+.|+..|....
T Consensus       113 FaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~~  169 (278)
T PF15135_consen  113 FACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGFA  169 (278)
T ss_pred             eeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchhhh
Confidence            77888866433333333334467778777766      3344689999999998553


No 84 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.24  E-value=0.13  Score=36.53  Aligned_cols=13  Identities=31%  Similarity=0.843  Sum_probs=9.8

Q ss_pred             ccCCCCcccccCc
Q psy13443        135 HACGMCGYECAQG  147 (188)
Q Consensus       135 ~~C~~C~~~f~~~  147 (188)
                      ..|+.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5799999887643


No 85 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=86.13  E-value=1.2  Score=33.82  Aligned_cols=24  Identities=17%  Similarity=0.467  Sum_probs=13.8

Q ss_pred             eecCC--CCCCCCCHHHHHHHHHhcC
Q psy13443         79 YMCYL--CNYHTPTRKYMRTHIDTHN  102 (188)
Q Consensus        79 ~~C~~--C~~~f~~~~~l~~H~~~h~  102 (188)
                      |.|+.  |.........|..|.++-+
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H  177 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQH  177 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhc
Confidence            55644  5555555666666666444


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.93  E-value=0.53  Score=29.56  Aligned_cols=29  Identities=17%  Similarity=0.400  Sum_probs=18.2

Q ss_pred             ecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCc
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRK  119 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~  119 (188)
                      .|+.||..|....           ..|..|+.||..|...
T Consensus        11 ~Cp~CG~kFYDLn-----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDLN-----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccCC-----------CCCccCCCCCCccCcc
Confidence            4677776665331           2566777777776665


No 87 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.90  E-value=0.48  Score=24.15  Aligned_cols=11  Identities=45%  Similarity=1.171  Sum_probs=6.2

Q ss_pred             ccCCCCCC-ccc
Q psy13443         42 FVCVHCKQ-FEV   52 (188)
Q Consensus        42 ~~C~~C~~-~~~   52 (188)
                      |.|..||. |..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            56666665 443


No 88 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.61  E-value=0.61  Score=23.95  Aligned_cols=26  Identities=38%  Similarity=0.623  Sum_probs=14.0

Q ss_pred             CCccCCCCcccccC----cHHHHHHHHHhc
Q psy13443        133 KPHACGMCGYECAQ----GSQLMQHLRKVH  158 (188)
Q Consensus       133 ~~~~C~~C~~~f~~----~~~l~~H~~~~h  158 (188)
                      ....|.+|++.+..    .+.|..|++..|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            34567777766654    367777775544


No 89 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.17  E-value=0.93  Score=30.20  Aligned_cols=35  Identities=17%  Similarity=0.432  Sum_probs=18.1

Q ss_pred             CCccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCC
Q psy13443         11 KQQFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQ   49 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~   49 (188)
                      ...|.|+.|+..|.....+..    ......|.|+.||.
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~----~d~~~~f~Cp~Cg~  131 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL----LDMDGTFTCPRCGE  131 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh----cCCCCcEECCCCCC
Confidence            345777777777664332211    11222267777765


No 90 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.78  E-value=0.63  Score=23.27  Aligned_cols=8  Identities=25%  Similarity=1.028  Sum_probs=4.5

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      |.|+.|+.
T Consensus         6 y~C~~Cg~   13 (41)
T smart00834        6 YRCEDCGH   13 (41)
T ss_pred             EEcCCCCC
Confidence            45555555


No 91 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.21  E-value=1  Score=30.43  Aligned_cols=31  Identities=19%  Similarity=0.351  Sum_probs=19.8

Q ss_pred             CCCccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCC
Q psy13443         10 AKQQFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQ   49 (188)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~   49 (188)
                      ....|.|+.|+..|+....+.         ..|.|+.||.
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~  136 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGA  136 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCC
Confidence            345677777777776665553         1377777765


No 92 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=84.05  E-value=0.17  Score=35.94  Aligned_cols=13  Identities=31%  Similarity=0.851  Sum_probs=9.9

Q ss_pred             eecccCccccCCc
Q psy13443        107 FRCALCAYSARRK  119 (188)
Q Consensus       107 ~~C~~C~~~~~~~  119 (188)
                      ..||.||.++...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5799999887543


No 93 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=83.81  E-value=0.68  Score=24.44  Aligned_cols=11  Identities=27%  Similarity=0.893  Sum_probs=7.2

Q ss_pred             ceecccCcccc
Q psy13443        106 PFRCALCAYSA  116 (188)
Q Consensus       106 ~~~C~~C~~~~  116 (188)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            46666677666


No 94 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=83.43  E-value=0.32  Score=35.13  Aligned_cols=26  Identities=35%  Similarity=0.640  Sum_probs=15.6

Q ss_pred             CCCccCCCCcccccCcHHHHHHHHHh
Q psy13443        132 EKPHACGMCGYECAQGSQLMQHLRKV  157 (188)
Q Consensus       132 ~~~~~C~~C~~~f~~~~~l~~H~~~~  157 (188)
                      .+++.|+.|++.......|..-.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            46677777776666555555444443


No 95 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.30  E-value=0.7  Score=30.12  Aligned_cols=25  Identities=32%  Similarity=0.515  Sum_probs=15.0

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhcCCC
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVHKVD  161 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~  161 (188)
                      ...|-+||+.|..   |.+|++.||+..
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             eeEEccCCcccch---HHHHHHHccCCC
Confidence            3678888888866   588888888754


No 96 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=81.31  E-value=1.9  Score=29.08  Aligned_cols=32  Identities=16%  Similarity=0.284  Sum_probs=21.4

Q ss_pred             CCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        103 GEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       103 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      ...-|.|+.|+..|+....+.         .-|.|+.||..
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            344577888887777766653         24788888765


No 97 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=80.64  E-value=0.33  Score=32.55  Aligned_cols=17  Identities=12%  Similarity=0.225  Sum_probs=11.8

Q ss_pred             ceecccCccccCCchhH
Q psy13443        106 PFRCALCAYSARRKTHL  122 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l  122 (188)
                      .+.|+.||+.|.....+
T Consensus        28 ~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeccccCCcceEeEec
Confidence            37777888777776554


No 98 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=80.64  E-value=1.8  Score=22.85  Aligned_cols=23  Identities=39%  Similarity=0.824  Sum_probs=13.2

Q ss_pred             cCCCCcccccCc-----HHHHHHHHHhc
Q psy13443        136 ACGMCGYECAQG-----SQLMQHLRKVH  158 (188)
Q Consensus       136 ~C~~C~~~f~~~-----~~l~~H~~~~h  158 (188)
                      .|..|++.+...     +.|.+|++..|
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            566666555433     57777776443


No 99 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=80.52  E-value=4.1  Score=27.13  Aligned_cols=37  Identities=16%  Similarity=0.284  Sum_probs=19.9

Q ss_pred             CCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccc
Q psy13443        104 EKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYEC  144 (188)
Q Consensus       104 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  144 (188)
                      ...|.|+.|+..|.....+..   .. ....|.|+.||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LD-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cC-CCCcEECCCCCCEE
Confidence            345777777777665433221   01 12337777777654


No 100
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=80.38  E-value=1.8  Score=19.45  Aligned_cols=19  Identities=26%  Similarity=0.496  Sum_probs=13.2

Q ss_pred             cCCCCcccccCcHHHHHHHH
Q psy13443        136 ACGMCGYECAQGSQLMQHLR  155 (188)
Q Consensus       136 ~C~~C~~~f~~~~~l~~H~~  155 (188)
                      .|++|++.+ ....+..|+-
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577787777 5567777764


No 101
>PF12907 zf-met2:  Zinc-binding
Probab=79.88  E-value=1.2  Score=22.46  Aligned_cols=27  Identities=22%  Similarity=0.444  Sum_probs=20.2

Q ss_pred             ccCCCCcccc---cCcHHHHHHHHHhcCCC
Q psy13443        135 HACGMCGYEC---AQGSQLMQHLRKVHKVD  161 (188)
Q Consensus       135 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~  161 (188)
                      +.|.+|..+|   .....|..|....|+..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            5788888665   44577999998888765


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=79.07  E-value=1.2  Score=23.63  Aligned_cols=11  Identities=18%  Similarity=0.615  Sum_probs=6.1

Q ss_pred             cccCCCccccc
Q psy13443         14 FECDFCPYGAK   24 (188)
Q Consensus        14 ~~C~~C~~~f~   24 (188)
                      |.|+.|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555554


No 103
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=78.53  E-value=1.6  Score=30.09  Aligned_cols=29  Identities=21%  Similarity=0.458  Sum_probs=16.9

Q ss_pred             CccccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCC
Q psy13443         12 QQFECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQ   49 (188)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~   49 (188)
                      ..|.|+.|+..|+....+.         ..|.|+.||.
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~  144 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGE  144 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCC
Confidence            4567777776666554432         1366666665


No 104
>KOG2186|consensus
Probab=78.31  E-value=1.2  Score=32.18  Aligned_cols=54  Identities=22%  Similarity=0.516  Sum_probs=42.8

Q ss_pred             eecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhcCCCCC
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVHKVDKK  163 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  163 (188)
                      |.|.+||....-. .+..|+....+ ..|.|--|+..|-. .....|.........|
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            7899999887654 56679998877 67999999999988 6778998877654443


No 105
>KOG2231|consensus
Probab=78.16  E-value=3.9  Score=34.12  Aligned_cols=69  Identities=16%  Similarity=0.231  Sum_probs=38.1

Q ss_pred             cCHHHHHHHHHhhhc-CCc----ccCCCCCC-cccccccccccccccccccccccCCCCceeecCCC------CCCCCCH
Q psy13443         24 KQAADVHNHVQQIHM-GVN----FVCVHCKQ-FEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLC------NYHTPTR   91 (188)
Q Consensus        24 ~~~~~l~~H~~~~~~-~~~----~~C~~C~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C------~~~f~~~   91 (188)
                      .+...|..|++.--. .+.    -.|..|.. |.....+..|....              -|.|..|      +..|...
T Consensus       160 Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~--------------h~~chfC~~~~~~neyy~~~  225 (669)
T KOG2231|consen  160 YTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFD--------------HEFCHFCDYKTGQNEYYNDY  225 (669)
T ss_pred             ehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccc--------------eeheeecCcccccchhcccc
Confidence            345666777632222 111    35666666 55555555555431              1334444      4566777


Q ss_pred             HHHHHHHHhcCCCCceecc
Q psy13443         92 KYMRTHIDTHNGEKPFRCA  110 (188)
Q Consensus        92 ~~l~~H~~~h~~~~~~~C~  110 (188)
                      ..|..|.+.++    |.|.
T Consensus       226 ~dLe~HfR~~H----flCE  240 (669)
T KOG2231|consen  226 DDLEEHFRKGH----FLCE  240 (669)
T ss_pred             hHHHHHhhhcC----cccc
Confidence            78888887765    6666


No 106
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=78.16  E-value=1.7  Score=30.01  Aligned_cols=30  Identities=20%  Similarity=0.384  Sum_probs=16.0

Q ss_pred             CceecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        105 KPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      .-|.|+.|+..|+....+.         .-|.|+.||..
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            3456666665555554431         23666666644


No 107
>PHA00626 hypothetical protein
Probab=77.81  E-value=1.8  Score=23.39  Aligned_cols=11  Identities=36%  Similarity=1.141  Sum_probs=5.4

Q ss_pred             eecCCCCCCCC
Q psy13443         79 YMCYLCNYHTP   89 (188)
Q Consensus        79 ~~C~~C~~~f~   89 (188)
                      |.|+.|+..|+
T Consensus        24 YkCkdCGY~ft   34 (59)
T PHA00626         24 YVCCDCGYNDS   34 (59)
T ss_pred             eEcCCCCCeec
Confidence            45555554443


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=76.42  E-value=1.8  Score=27.88  Aligned_cols=15  Identities=7%  Similarity=0.025  Sum_probs=8.3

Q ss_pred             CceecccCccccCCc
Q psy13443        105 KPFRCALCAYSARRK  119 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~  119 (188)
                      .|..|+.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            455666666555444


No 109
>KOG2807|consensus
Probab=76.35  E-value=4.9  Score=30.32  Aligned_cols=25  Identities=12%  Similarity=0.151  Sum_probs=16.6

Q ss_pred             CCccCCCCcccccCcHHHHHHHHHh
Q psy13443        133 KPHACGMCGYECAQGSQLMQHLRKV  157 (188)
Q Consensus       133 ~~~~C~~C~~~f~~~~~l~~H~~~~  157 (188)
                      ..|.|..|...|..--+...|-..|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3477777777777766666665544


No 110
>KOG2785|consensus
Probab=75.88  E-value=4.4  Score=31.24  Aligned_cols=52  Identities=19%  Similarity=0.361  Sum_probs=44.4

Q ss_pred             ceeecCCCCCCCCCHHHHHHHHHhcCCC-----------------------CceecccCc---cccCCchhHHHHHHh
Q psy13443         77 YTYMCYLCNYHTPTRKYMRTHIDTHNGE-----------------------KPFRCALCA---YSARRKTHLDDHMRR  128 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~~~~~~~l~~H~~~  128 (188)
                      .|-.|-.|++.+.+-.....||..+++-                       .-+.|..|.   +.|.+....+.||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            3577999999999999999999988874                       236788888   999999999999975


No 111
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=75.05  E-value=2.5  Score=23.08  Aligned_cols=41  Identities=24%  Similarity=0.630  Sum_probs=20.6

Q ss_pred             Cceeccc-CccccCCchhHHHHHHhhcCCCCccCCC----Cccccc
Q psy13443        105 KPFRCAL-CAYSARRKTHLDDHMRRHTGEKPHACGM----CGYECA  145 (188)
Q Consensus       105 ~~~~C~~-C~~~~~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~  145 (188)
                      .+..|+. |+..-.....|..|.......++..|++    |...+.
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            3456666 3333233456677777555566677777    766554


No 112
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=74.57  E-value=1.4  Score=32.84  Aligned_cols=91  Identities=15%  Similarity=0.291  Sum_probs=53.1

Q ss_pred             ccccccccccCCCCceeecCCCCCCCCCHHHHHHHHHh----------cCCC--CceecccCccccCCchhHHHHHHhhc
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYHTPTRKYMRTHIDT----------HNGE--KPFRCALCAYSARRKTHLDDHMRRHT  130 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~----------h~~~--~~~~C~~C~~~~~~~~~l~~H~~~h~  130 (188)
                      +|+.|...+-   ..|..|+.|+........|.....-          ..+.  +.--|-.|...|.....-..  -.-+
T Consensus       310 ~CP~CktkVC---sLPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~--~~~~  384 (421)
T COG5151         310 ECPVCKTKVC---SLPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPF--DEST  384 (421)
T ss_pred             eCCcccceee---cCCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCcc--cccc
Confidence            5666655543   3567899998776655555443321          1111  12236667777765432111  0112


Q ss_pred             CCCCccCCCCcccccCcHHHHHHHHHhc
Q psy13443        131 GEKPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       131 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      ....|+|+.|...|..--+...|-..|.
T Consensus       385 ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         385 SSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cccceechhhhhhhhhhhHHHHHHHHhh
Confidence            2345999999999988888888866553


No 113
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=74.05  E-value=3.1  Score=21.34  Aligned_cols=22  Identities=23%  Similarity=0.818  Sum_probs=19.5

Q ss_pred             ccccCCCcccccCHHHHHHHHH
Q psy13443         13 QFECDFCPYGAKQAADVHNHVQ   34 (188)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~H~~   34 (188)
                      .|+|-.|..+...++.|.+||.
T Consensus        20 ~ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             cceeecCCcccchHHHHHHHHH
Confidence            3789999999999999999984


No 114
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=73.95  E-value=3  Score=35.38  Aligned_cols=29  Identities=34%  Similarity=0.875  Sum_probs=17.0

Q ss_pred             hcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        100 THNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       100 ~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      .|...+...|..||..               ...|..|+.||..
T Consensus       456 ~H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         456 LHKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             EecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            3344455677777743               2346677777754


No 115
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=73.83  E-value=2.2  Score=22.09  Aligned_cols=8  Identities=25%  Similarity=1.144  Sum_probs=4.3

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      |.|+.||.
T Consensus         4 y~C~~CG~   11 (46)
T PRK00398          4 YKCARCGR   11 (46)
T ss_pred             EECCCCCC
Confidence            45555555


No 116
>PF14353 CpXC:  CpXC protein
Probab=73.54  E-value=2.2  Score=27.60  Aligned_cols=14  Identities=14%  Similarity=0.444  Sum_probs=7.4

Q ss_pred             eeecCCCCCCCCCH
Q psy13443         78 TYMCYLCNYHTPTR   91 (188)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (188)
                      .+.|+.||..|...
T Consensus        38 ~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   38 SFTCPSCGHKFRLE   51 (128)
T ss_pred             EEECCCCCCceecC
Confidence            35566666555433


No 117
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=72.86  E-value=1.9  Score=33.81  Aligned_cols=30  Identities=13%  Similarity=0.412  Sum_probs=18.6

Q ss_pred             ccccccccccCCCCceeecCCCCCCCCCHH
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYHTPTRK   92 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~   92 (188)
                      .|+.||....+.+..-|.|+.|++.++...
T Consensus       352 ~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSAGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhcCCCCcccccccccCCccc
Confidence            466666666666666666666666655443


No 118
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=71.33  E-value=3.3  Score=21.84  Aligned_cols=11  Identities=27%  Similarity=1.032  Sum_probs=6.1

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      .+.|+.|+..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45566666543


No 119
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=70.46  E-value=1.3  Score=25.62  Aligned_cols=14  Identities=21%  Similarity=0.517  Sum_probs=7.1

Q ss_pred             CCccCC--CCcccccC
Q psy13443        133 KPHACG--MCGYECAQ  146 (188)
Q Consensus       133 ~~~~C~--~C~~~f~~  146 (188)
                      .-++|.  .||.+|.+
T Consensus        26 ~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         26 RYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeecCCCCCCCEEEE
Confidence            334555  55555544


No 120
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=70.40  E-value=4.3  Score=29.39  Aligned_cols=61  Identities=13%  Similarity=0.181  Sum_probs=29.8

Q ss_pred             CCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCc
Q psy13443         74 DASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQG  147 (188)
Q Consensus        74 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  147 (188)
                      ...+.|.|..|+..        .-.++.....+.+|..|.+.|.-...-    + -=|-.-|.|+.|+..|...
T Consensus       108 ~~drqFaC~~Cd~~--------WwRrvp~rKeVSRCr~C~~rYDPVP~d----k-mwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  108 SVDRQFACSSCDHM--------WWRRVPQRKEVSRCRKCRKRYDPVPCD----K-MWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             ccceeeeccccchH--------HHhccCcccccccccccccccCCCccc----c-ccceeeeecccccccchhh
Confidence            55577889998632        122333344445566666555443210    0 0122235666666655533


No 121
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=69.94  E-value=3  Score=25.04  Aligned_cols=13  Identities=38%  Similarity=0.984  Sum_probs=7.6

Q ss_pred             ceecccCccccCC
Q psy13443        106 PFRCALCAYSARR  118 (188)
Q Consensus       106 ~~~C~~C~~~~~~  118 (188)
                      |-.|..||+.|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4556666666655


No 122
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=69.39  E-value=4.9  Score=20.77  Aligned_cols=28  Identities=21%  Similarity=0.525  Sum_probs=15.8

Q ss_pred             ceecccCccccCCchhHHHHHHhhcCCCCccCCCCcc
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGY  142 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  142 (188)
                      .+.|+.||..  ....+.       +...|+|..|++
T Consensus        18 g~~CP~Cg~~--~~~~~~-------~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGST--KHYRLK-------TRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCe--eeEEeC-------CCCeEECCCCCC
Confidence            3678888865  111111       145578887765


No 123
>PRK04023 DNA polymerase II large subunit; Validated
Probab=68.71  E-value=5.5  Score=34.90  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=4.0

Q ss_pred             ccCCCCcc
Q psy13443        135 HACGMCGY  142 (188)
Q Consensus       135 ~~C~~C~~  142 (188)
                      +.|+.|+.
T Consensus       664 y~CPKCG~  671 (1121)
T PRK04023        664 DECEKCGR  671 (1121)
T ss_pred             CcCCCCCC
Confidence            44555553


No 124
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=68.32  E-value=3.6  Score=29.26  Aligned_cols=29  Identities=21%  Similarity=0.365  Sum_probs=22.0

Q ss_pred             CCCccCCCCcccccCcHHHHHHHHHhcCC
Q psy13443        132 EKPHACGMCGYECAQGSQLMQHLRKVHKV  160 (188)
Q Consensus       132 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  160 (188)
                      +..|.|+.|++.|.-..-+.+|+...|.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            34489999999999999999999998853


No 125
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=68.04  E-value=3.1  Score=19.80  Aligned_cols=6  Identities=33%  Similarity=0.877  Sum_probs=2.5

Q ss_pred             ecCCCC
Q psy13443         80 MCYLCN   85 (188)
Q Consensus        80 ~C~~C~   85 (188)
                      .|+.||
T Consensus        19 rC~~CG   24 (32)
T PF03604_consen   19 RCPECG   24 (32)
T ss_dssp             SBSSSS
T ss_pred             ECCcCC
Confidence            344444


No 126
>KOG1280|consensus
Probab=66.44  E-value=11  Score=28.88  Aligned_cols=22  Identities=23%  Similarity=0.478  Sum_probs=12.8

Q ss_pred             eeecCCCCCCCCCHHHHHHHHH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHID   99 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~   99 (188)
                      .|.|+.|+.+-.+...|..|+.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~  100 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVL  100 (381)
T ss_pred             cccCCcccccccchhHHHHHhh
Confidence            4566666665555555666654


No 127
>KOG2593|consensus
Probab=66.04  E-value=4.9  Score=31.55  Aligned_cols=37  Identities=14%  Similarity=0.319  Sum_probs=23.5

Q ss_pred             cCCCccccCCCcccccCHHHHHHHHHhhhc-CCcccCCCCCC
Q psy13443          9 LAKQQFECDFCPYGAKQAADVHNHVQQIHM-GVNFVCVHCKQ   49 (188)
Q Consensus         9 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~-~~~~~C~~C~~   49 (188)
                      +....|.|+.|.+.|.....+.    .... .-.|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH----hhcccCceEEEecCCC
Confidence            4445688888888887655442    2333 23488888864


No 128
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=66.01  E-value=2  Score=22.86  Aligned_cols=11  Identities=36%  Similarity=0.981  Sum_probs=7.0

Q ss_pred             cccCCCccccc
Q psy13443         14 FECDFCPYGAK   24 (188)
Q Consensus        14 ~~C~~C~~~f~   24 (188)
                      |.|..|+..|.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56677776554


No 129
>KOG4118|consensus
Probab=65.79  E-value=3.2  Score=23.20  Aligned_cols=31  Identities=19%  Similarity=0.400  Sum_probs=26.1

Q ss_pred             ccCCCCcccccCcHHHHHHHHHhcCCCCCCC
Q psy13443        135 HACGMCGYECAQGSQLMQHLRKVHKVDKKGG  165 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~  165 (188)
                      |+|.+|.-.-..+..+..|....|+..++..
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~~P~   69 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEPLPE   69 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCCCCH
Confidence            7899998888888888999999998887753


No 130
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=62.98  E-value=5.2  Score=17.36  Aligned_cols=6  Identities=33%  Similarity=0.855  Sum_probs=3.0

Q ss_pred             cCCCCC
Q psy13443         81 CYLCNY   86 (188)
Q Consensus        81 C~~C~~   86 (188)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555553


No 131
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=62.36  E-value=4.9  Score=21.34  Aligned_cols=10  Identities=30%  Similarity=1.149  Sum_probs=5.6

Q ss_pred             ceecccCccc
Q psy13443        106 PFRCALCAYS  115 (188)
Q Consensus       106 ~~~C~~C~~~  115 (188)
                      .+.|..|+..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4566666554


No 132
>KOG2593|consensus
Probab=61.96  E-value=8.1  Score=30.40  Aligned_cols=38  Identities=16%  Similarity=0.316  Sum_probs=22.2

Q ss_pred             cCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCc
Q psy13443        101 HNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCG  141 (188)
Q Consensus       101 h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~  141 (188)
                      .+....|.|+.|.+.|.....++-   +-.....|.|..|+
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             ccccccccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            344456788888877777655432   11113457777776


No 133
>PF12773 DZR:  Double zinc ribbon
Probab=61.89  E-value=6.4  Score=20.57  Aligned_cols=8  Identities=25%  Similarity=0.646  Sum_probs=3.6

Q ss_pred             eecCCCCC
Q psy13443         79 YMCYLCNY   86 (188)
Q Consensus        79 ~~C~~C~~   86 (188)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34444443


No 134
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=61.22  E-value=12  Score=33.89  Aligned_cols=34  Identities=21%  Similarity=0.482  Sum_probs=18.4

Q ss_pred             ccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCC
Q psy13443         42 FVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYH   87 (188)
Q Consensus        42 ~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~   87 (188)
                      +.|+.||.....        ..|+.||....    ..|.|+.|+..
T Consensus       668 rkCPkCG~~t~~--------~fCP~CGs~te----~vy~CPsCGae  701 (1337)
T PRK14714        668 RRCPSCGTETYE--------NRCPDCGTHTE----PVYVCPDCGAE  701 (1337)
T ss_pred             EECCCCCCcccc--------ccCcccCCcCC----CceeCccCCCc
Confidence            678888762110        15666665542    24566666654


No 135
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=61.09  E-value=6.4  Score=32.05  Aligned_cols=16  Identities=38%  Similarity=0.897  Sum_probs=9.0

Q ss_pred             hcCCCCceecccCccc
Q psy13443        100 THNGEKPFRCALCAYS  115 (188)
Q Consensus       100 ~h~~~~~~~C~~C~~~  115 (188)
                      .|.......|..||..
T Consensus       234 ~h~~~~~l~Ch~Cg~~  249 (505)
T TIGR00595       234 YHKKEGKLRCHYCGYQ  249 (505)
T ss_pred             EecCCCeEEcCCCcCc
Confidence            3444455677777743


No 136
>KOG1280|consensus
Probab=60.36  E-value=10  Score=28.94  Aligned_cols=40  Identities=23%  Similarity=0.492  Sum_probs=31.6

Q ss_pred             CCCccccCCCcccccCHHHHHHHHHhhhcCCc--ccCCCCCC
Q psy13443         10 AKQQFECDFCPYGAKQAADVHNHVQQIHMGVN--FVCVHCKQ   49 (188)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~--~~C~~C~~   49 (188)
                      .+.-|.|+.|++.-.+...|..|....|.+.+  ..|+.|..
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            34469999999988888999999988887765  56777755


No 137
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=60.32  E-value=11  Score=18.90  Aligned_cols=13  Identities=23%  Similarity=0.501  Sum_probs=8.6

Q ss_pred             ceeecCCCCCCCC
Q psy13443         77 YTYMCYLCNYHTP   89 (188)
Q Consensus        77 ~~~~C~~C~~~f~   89 (188)
                      ..|.|..|+..+.
T Consensus        27 ~fy~C~~C~~~w~   39 (40)
T smart00440       27 VFYVCTKCGHRWR   39 (40)
T ss_pred             EEEEeCCCCCEeC
Confidence            3577888876543


No 138
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=60.18  E-value=7.9  Score=19.30  Aligned_cols=13  Identities=15%  Similarity=0.324  Sum_probs=8.5

Q ss_pred             eeecCCCCCCCCC
Q psy13443         78 TYMCYLCNYHTPT   90 (188)
Q Consensus        78 ~~~C~~C~~~f~~   90 (188)
                      +|.|..|+..|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            5667777766653


No 139
>PRK04023 DNA polymerase II large subunit; Validated
Probab=59.47  E-value=12  Score=32.98  Aligned_cols=8  Identities=25%  Similarity=0.688  Sum_probs=4.3

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      ..|+.||.
T Consensus       627 RfCpsCG~  634 (1121)
T PRK04023        627 RKCPSCGK  634 (1121)
T ss_pred             ccCCCCCC
Confidence            45555555


No 140
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=59.16  E-value=7.3  Score=21.09  Aligned_cols=10  Identities=40%  Similarity=0.766  Sum_probs=4.8

Q ss_pred             cccCCCcccc
Q psy13443         14 FECDFCPYGA   23 (188)
Q Consensus        14 ~~C~~C~~~f   23 (188)
                      ++|+.|+..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            3455555443


No 141
>KOG3408|consensus
Probab=57.53  E-value=6.1  Score=25.21  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=19.0

Q ss_pred             CCCccCCCCcccccCcHHHHHHHHH
Q psy13443        132 EKPHACGMCGYECAQGSQLMQHLRK  156 (188)
Q Consensus       132 ~~~~~C~~C~~~f~~~~~l~~H~~~  156 (188)
                      ...|-|-.|.+.|.+...|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3347788888888888888888764


No 142
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=56.65  E-value=7.2  Score=25.40  Aligned_cols=25  Identities=20%  Similarity=0.182  Sum_probs=19.5

Q ss_pred             ccCCCCcccccCcHHHHHHHHHhcCCCC
Q psy13443        135 HACGMCGYECAQGSQLMQHLRKVHKVDK  162 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~  162 (188)
                      +.|-.+|+.|.   +|.+|+.+|++..|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            67888888884   58899988887654


No 143
>PRK14873 primosome assembly protein PriA; Provisional
Probab=56.53  E-value=7.5  Score=32.84  Aligned_cols=26  Identities=23%  Similarity=0.595  Sum_probs=15.6

Q ss_pred             CCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        102 NGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       102 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      ...+...|..||..                ..|..|+.|+..
T Consensus       406 ~~~~~l~Ch~CG~~----------------~~p~~Cp~Cgs~  431 (665)
T PRK14873        406 SAGGTPRCRWCGRA----------------APDWRCPRCGSD  431 (665)
T ss_pred             cCCCeeECCCCcCC----------------CcCccCCCCcCC
Confidence            33445677777742                124578888754


No 144
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=56.22  E-value=7  Score=20.68  Aligned_cols=10  Identities=20%  Similarity=0.554  Sum_probs=4.1

Q ss_pred             eecccCcccc
Q psy13443        107 FRCALCAYSA  116 (188)
Q Consensus       107 ~~C~~C~~~~  116 (188)
                      +.|..||..|
T Consensus         5 l~C~dCg~~F   14 (49)
T PF13451_consen    5 LTCKDCGAEF   14 (49)
T ss_pred             EEcccCCCeE
Confidence            3444444443


No 145
>KOG3214|consensus
Probab=55.56  E-value=7.4  Score=23.86  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=6.9

Q ss_pred             eecccCccccCCc
Q psy13443        107 FRCALCAYSARRK  119 (188)
Q Consensus       107 ~~C~~C~~~~~~~  119 (188)
                      ..|.+|+.+|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4555555555543


No 146
>KOG2907|consensus
Probab=54.17  E-value=4.6  Score=25.38  Aligned_cols=38  Identities=18%  Similarity=0.444  Sum_probs=21.2

Q ss_pred             eecccCccccCCchhHHHHHHhhcC--CCCccCCCCcccccC
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTG--EKPHACGMCGYECAQ  146 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~--~~~~~C~~C~~~f~~  146 (188)
                      .+|+.||..=.....++  +|..-.  --.|.|+.|++.|+.
T Consensus        75 ~kCpkCghe~m~Y~T~Q--lRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQ--LRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhh--cccccCCceEEEEcCccceeeec
Confidence            57888886544433332  222211  123888888887764


No 147
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=53.07  E-value=17  Score=32.99  Aligned_cols=53  Identities=23%  Similarity=0.449  Sum_probs=33.2

Q ss_pred             cccCCCcccccCHHHHHHHHHhhhcCCcccCCCCCCcccccccccccccccccccccccCCCCceeecCCCCCCCC
Q psy13443         14 FECDFCPYGAKQAADVHNHVQQIHMGVNFVCVHCKQFEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLCNYHTP   89 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C~~~f~   89 (188)
                      +.|+.||....                ...|+.||...       .....|+.|+..+.........|+.|+....
T Consensus       668 rkCPkCG~~t~----------------~~fCP~CGs~t-------e~vy~CPsCGaev~~des~a~~CP~CGtplv  720 (1337)
T PRK14714        668 RRCPSCGTETY----------------ENRCPDCGTHT-------EPVYVCPDCGAEVPPDESGRVECPRCDVELT  720 (1337)
T ss_pred             EECCCCCCccc----------------cccCcccCCcC-------CCceeCccCCCccCCCccccccCCCCCCccc
Confidence            78999997411                12688887721       1123788888876654333557999985443


No 148
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=53.01  E-value=7.6  Score=23.90  Aligned_cols=8  Identities=38%  Similarity=1.202  Sum_probs=7.1

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      |.|+.|+.
T Consensus        23 FtCp~Cgh   30 (104)
T COG4888          23 FTCPRCGH   30 (104)
T ss_pred             EecCccCC
Confidence            89999987


No 149
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=52.68  E-value=6.3  Score=19.62  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=7.9

Q ss_pred             ceeecCCCCCCC
Q psy13443         77 YTYMCYLCNYHT   88 (188)
Q Consensus        77 ~~~~C~~C~~~f   88 (188)
                      ..|.|..|+..+
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            347788887644


No 150
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=52.59  E-value=9.9  Score=30.00  Aligned_cols=29  Identities=21%  Similarity=0.557  Sum_probs=18.7

Q ss_pred             ecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCc
Q psy13443        108 RCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQG  147 (188)
Q Consensus       108 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  147 (188)
                      .|+.||....+.           |..-|+|+.|++.+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            677777665543           22267888888777654


No 151
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=52.56  E-value=11  Score=23.33  Aligned_cols=16  Identities=19%  Similarity=0.486  Sum_probs=11.5

Q ss_pred             CceecccCccccCCch
Q psy13443        105 KPFRCALCAYSARRKT  120 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~  120 (188)
                      +|++|..||..|..-+
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            3567888888887743


No 152
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=52.18  E-value=32  Score=26.01  Aligned_cols=25  Identities=20%  Similarity=0.369  Sum_probs=17.0

Q ss_pred             CceecccCccccCCchhHHHHHHhh
Q psy13443        105 KPFRCALCAYSARRKTHLDDHMRRH  129 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~~l~~H~~~h  129 (188)
                      ..|.|+.|-..|...-+.-.|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            4577777777777766666666665


No 153
>KOG4173|consensus
Probab=52.06  E-value=9.1  Score=26.95  Aligned_cols=51  Identities=22%  Similarity=0.511  Sum_probs=39.8

Q ss_pred             Cceeccc--CccccCCchhHHHHHHhhcCCCCccCCCCcccccCcHHHHHHHHHhc
Q psy13443        105 KPFRCAL--CAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       105 ~~~~C~~--C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      ..+.|++  |...|.....+..|--+-++   -.|..|.+.|.+...|..|+---|
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~H  130 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWH  130 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHH
Confidence            4577887  77888888877777654333   379999999999999999986544


No 154
>PRK00420 hypothetical protein; Validated
Probab=51.86  E-value=11  Score=23.82  Aligned_cols=11  Identities=9%  Similarity=0.114  Sum_probs=5.5

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      ...|+.|+...
T Consensus        40 ~~~Cp~Cg~~~   50 (112)
T PRK00420         40 EVVCPVHGKVY   50 (112)
T ss_pred             ceECCCCCCee
Confidence            34555555433


No 155
>KOG3408|consensus
Probab=51.41  E-value=10  Score=24.19  Aligned_cols=25  Identities=24%  Similarity=0.320  Sum_probs=21.8

Q ss_pred             CCCccccCCCcccccCHHHHHHHHH
Q psy13443         10 AKQQFECDFCPYGAKQAADVHNHVQ   34 (188)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~H~~   34 (188)
                      |-..|-|-.|.+-|.+...|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            4456899999999999999999984


No 156
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=50.98  E-value=11  Score=32.07  Aligned_cols=21  Identities=19%  Similarity=0.422  Sum_probs=12.6

Q ss_pred             ccccccccccCCCCceeecCCCCCC
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYH   87 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~   87 (188)
                      .|..|+..    ...|..|+.|+..
T Consensus       464 ~CH~Cg~~----~~~p~~Cp~Cgs~  484 (730)
T COG1198         464 RCHYCGYQ----EPIPQSCPECGSE  484 (730)
T ss_pred             EeCCCCCC----CCCCCCCCCCCCC
Confidence            45555554    2456778888743


No 157
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=50.93  E-value=9.5  Score=27.22  Aligned_cols=30  Identities=20%  Similarity=0.356  Sum_probs=23.3

Q ss_pred             CCCccccCCCcccccCHHHHHHHHHhhhcC
Q psy13443         10 AKQQFECDFCPYGAKQAADVHNHVQQIHMG   39 (188)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   39 (188)
                      .+.-|.|..|++.|.-..-+..|+...|.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            445699999999999999999999888865


No 158
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=50.36  E-value=11  Score=17.27  Aligned_cols=10  Identities=30%  Similarity=1.118  Sum_probs=3.9

Q ss_pred             ceeecCCCCC
Q psy13443         77 YTYMCYLCNY   86 (188)
Q Consensus        77 ~~~~C~~C~~   86 (188)
                      ..|.|.+|+.
T Consensus        14 ~~Y~C~~Cdf   23 (30)
T PF07649_consen   14 WFYRCSECDF   23 (30)
T ss_dssp             -EEE-TTT--
T ss_pred             ceEECccCCC
Confidence            4566666654


No 159
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=50.33  E-value=7.2  Score=18.25  Aligned_cols=8  Identities=25%  Similarity=0.779  Sum_probs=3.6

Q ss_pred             ceecccCc
Q psy13443        106 PFRCALCA  113 (188)
Q Consensus       106 ~~~C~~C~  113 (188)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444444


No 160
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.28  E-value=6  Score=21.15  Aligned_cols=20  Identities=25%  Similarity=0.353  Sum_probs=6.7

Q ss_pred             eeecCCCCCCCCCHHHHHHH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTH   97 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H   97 (188)
                      .|.|+.|...|-..=.+-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            45555555555444333333


No 161
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=49.82  E-value=16  Score=20.58  Aligned_cols=10  Identities=30%  Similarity=1.036  Sum_probs=4.6

Q ss_pred             ceecccCccc
Q psy13443        106 PFRCALCAYS  115 (188)
Q Consensus       106 ~~~C~~C~~~  115 (188)
                      .|.|+.||..
T Consensus        46 ~~~C~~Cg~~   55 (69)
T PF07282_consen   46 VFTCPNCGFE   55 (69)
T ss_pred             eEEcCCCCCE
Confidence            3444444444


No 162
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.16  E-value=3.2  Score=29.71  Aligned_cols=39  Identities=23%  Similarity=0.636  Sum_probs=21.3

Q ss_pred             CceecccCccccCCchhHHHHHHhhcCC----------CC-----ccCCCCccc
Q psy13443        105 KPFRCALCAYSARRKTHLDDHMRRHTGE----------KP-----HACGMCGYE  143 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~----------~~-----~~C~~C~~~  143 (188)
                      +.+.||+|+..|.....+..-.++-.|+          -|     ..||.|..+
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             ceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            4466777776666554443333333332          11     478888865


No 163
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=48.99  E-value=12  Score=22.62  Aligned_cols=14  Identities=14%  Similarity=0.285  Sum_probs=9.0

Q ss_pred             ceeecCCCCCCCCC
Q psy13443         77 YTYMCYLCNYHTPT   90 (188)
Q Consensus        77 ~~~~C~~C~~~f~~   90 (188)
                      ..+.|..|++.|..
T Consensus        53 GIW~C~~C~~~~AG   66 (90)
T PTZ00255         53 GIWRCKGCKKTVAG   66 (90)
T ss_pred             EEEEcCCCCCEEeC
Confidence            34677777776643


No 164
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=48.35  E-value=25  Score=17.68  Aligned_cols=23  Identities=17%  Similarity=0.310  Sum_probs=13.1

Q ss_pred             ccCCCCcccccC--cHHHHHHHHHh
Q psy13443        135 HACGMCGYECAQ--GSQLMQHLRKV  157 (188)
Q Consensus       135 ~~C~~C~~~f~~--~~~l~~H~~~~  157 (188)
                      ..|+.|+..|..  +.+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            467777766543  45555555443


No 165
>KOG4167|consensus
Probab=48.26  E-value=4.8  Score=33.84  Aligned_cols=27  Identities=15%  Similarity=0.213  Sum_probs=22.7

Q ss_pred             CCccccCCCcccccCHHHHHHHHHhhh
Q psy13443         11 KQQFECDFCPYGAKQAADVHNHVQQIH   37 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~H~~~~~   37 (188)
                      ...|.|..|++.|....++..||..|-
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            457999999999999999999995443


No 166
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=48.09  E-value=17  Score=29.21  Aligned_cols=32  Identities=19%  Similarity=0.281  Sum_probs=26.5

Q ss_pred             ccCCCccccCCCcccccCHHHHHHHHHhhhcC
Q psy13443          8 HLAKQQFECDFCPYGAKQAADVHNHVQQIHMG   39 (188)
Q Consensus         8 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   39 (188)
                      +...+.+.|+.|.+.|.+...+..|+...|.+
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            33445678999999999999999999877765


No 167
>KOG2636|consensus
Probab=47.47  E-value=15  Score=29.15  Aligned_cols=27  Identities=22%  Similarity=0.527  Sum_probs=21.7

Q ss_pred             ccCCCccccCCCc-ccccCHHHHHHHHH
Q psy13443          8 HLAKQQFECDFCP-YGAKQAADVHNHVQ   34 (188)
Q Consensus         8 h~~~~~~~C~~C~-~~f~~~~~l~~H~~   34 (188)
                      |.-...|.|.+|| +++.....+.+|+.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            4456679999999 78888888888874


No 168
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=47.23  E-value=15  Score=29.57  Aligned_cols=28  Identities=14%  Similarity=0.380  Sum_probs=23.3

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhcCCC
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVHKVD  161 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~  161 (188)
                      .+.|+.|.+.|.....+..|+...|...
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            4789999999999999999998877544


No 169
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=46.65  E-value=12  Score=17.91  Aligned_cols=11  Identities=18%  Similarity=0.528  Sum_probs=5.9

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      -+.|..|+..|
T Consensus        21 ~~~C~~Cg~~~   31 (33)
T PF08792_consen   21 YEVCIFCGSSF   31 (33)
T ss_pred             eEEcccCCcEe
Confidence            34566665544


No 170
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=45.51  E-value=7  Score=33.61  Aligned_cols=8  Identities=25%  Similarity=0.708  Sum_probs=0.0

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      +.|+.|+.
T Consensus       656 r~Cp~Cg~  663 (900)
T PF03833_consen  656 RRCPKCGK  663 (900)
T ss_dssp             --------
T ss_pred             ccCcccCC
Confidence            44555544


No 171
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=45.35  E-value=13  Score=23.58  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=6.5

Q ss_pred             eeecCCCCCCCC
Q psy13443         78 TYMCYLCNYHTP   89 (188)
Q Consensus        78 ~~~C~~C~~~f~   89 (188)
                      ...|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (115)
T TIGR00100        70 ECECEDCSEEVS   81 (115)
T ss_pred             EEEcccCCCEEe
Confidence            355666665544


No 172
>KOG3002|consensus
Probab=45.06  E-value=61  Score=24.57  Aligned_cols=109  Identities=19%  Similarity=0.321  Sum_probs=63.0

Q ss_pred             ccCCCCCCccccccccccccc-ccccccccccCCCCceeecCCCCCCCCCHHHHHHHHHhcCCCCceeccc----Ccccc
Q psy13443         42 FVCVHCKQFEVVPTRKTQTLE-HCATCVDMVRPDASYTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCAL----CAYSA  116 (188)
Q Consensus        42 ~~C~~C~~~~~~~~~~~~~~~-~c~~c~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~~  116 (188)
                      +.|+.|-.......++...+. .|..|..      +....|+.|...+.....+..=...  ......|+.    |...|
T Consensus        49 leCPvC~~~l~~Pi~QC~nGHlaCssC~~------~~~~~CP~Cr~~~g~~R~~amEkV~--e~~~vpC~~~~~GC~~~~  120 (299)
T KOG3002|consen   49 LDCPVCFNPLSPPIFQCDNGHLACSSCRT------KVSNKCPTCRLPIGNIRCRAMEKVA--EAVLVPCKNAKLGCTKSF  120 (299)
T ss_pred             ccCchhhccCcccceecCCCcEehhhhhh------hhcccCCccccccccHHHHHHHHHH--HhceecccccccCCceee
Confidence            568877664444444444433 4555543      3346899999888755443332222  223355653    77787


Q ss_pred             CCchhHHHHHHhhcCCCCccCCCCcccc---cCcHHHHHHHHHhcCC
Q psy13443        117 RRKTHLDDHMRRHTGEKPHACGMCGYEC---AQGSQLMQHLRKVHKV  160 (188)
Q Consensus       117 ~~~~~l~~H~~~h~~~~~~~C~~C~~~f---~~~~~l~~H~~~~h~~  160 (188)
                      ..... ..|.+.... .|+.|+.=+...   .....|..|.+.-|+.
T Consensus       121 ~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~  165 (299)
T KOG3002|consen  121 PYGEK-SKHEKVCEF-RPCSCPVPGAECKYTGSYKDLYAHLNDTHKS  165 (299)
T ss_pred             ccccc-ccccccccc-CCcCCCCCcccCCccCcHHHHHHHHHhhChh
Confidence            77766 566666554 677776542111   2346788888877755


No 173
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=44.45  E-value=15  Score=22.31  Aligned_cols=12  Identities=17%  Similarity=0.526  Sum_probs=8.3

Q ss_pred             eeecCCCCCCCC
Q psy13443         78 TYMCYLCNYHTP   89 (188)
Q Consensus        78 ~~~C~~C~~~f~   89 (188)
                      .+.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            467777777664


No 174
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=44.31  E-value=5.8  Score=26.41  Aligned_cols=14  Identities=14%  Similarity=0.185  Sum_probs=8.1

Q ss_pred             eecccCccccCCch
Q psy13443        107 FRCALCAYSARRKT  120 (188)
Q Consensus       107 ~~C~~C~~~~~~~~  120 (188)
                      -.|+.|+..|.+..
T Consensus        29 ReC~~C~~RFTTfE   42 (156)
T COG1327          29 RECLECGERFTTFE   42 (156)
T ss_pred             hcccccccccchhh
Confidence            35666666666543


No 175
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=44.22  E-value=8.9  Score=21.97  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=4.1

Q ss_pred             eeecCCCCCC
Q psy13443         78 TYMCYLCNYH   87 (188)
Q Consensus        78 ~~~C~~C~~~   87 (188)
                      .|.|..|...
T Consensus        17 ~~~C~~C~~~   26 (70)
T PF07191_consen   17 HYHCEACQKD   26 (70)
T ss_dssp             EEEETTT--E
T ss_pred             EEECcccccc
Confidence            4555555543


No 176
>KOG2807|consensus
Probab=43.72  E-value=57  Score=24.97  Aligned_cols=31  Identities=23%  Similarity=0.404  Sum_probs=21.0

Q ss_pred             CceecccCccccCCchhHHHHHHhhcCCCCccCCCCc
Q psy13443        105 KPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCG  141 (188)
Q Consensus       105 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~  141 (188)
                      ..|+|..|-..|...=+...|...|      .|+.|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence            4577777777777776666676666      466665


No 177
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=43.52  E-value=22  Score=19.02  Aligned_cols=12  Identities=17%  Similarity=0.681  Sum_probs=5.0

Q ss_pred             eecccCccccCC
Q psy13443        107 FRCALCAYSARR  118 (188)
Q Consensus       107 ~~C~~C~~~~~~  118 (188)
                      +.|+.|+..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            344444444333


No 178
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=43.45  E-value=21  Score=23.95  Aligned_cols=33  Identities=36%  Similarity=0.790  Sum_probs=14.5

Q ss_pred             ceeecCCCCCCCCCHHHHHHHHHhcCCCCceecccCcc
Q psy13443         77 YTYMCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAY  114 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  114 (188)
                      .+|.|. |+..|.+.   ..|-.+-.|+ .|.|..|+.
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCc
Confidence            345555 55544322   2232333333 455555553


No 179
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=43.33  E-value=13  Score=23.65  Aligned_cols=12  Identities=17%  Similarity=0.398  Sum_probs=7.2

Q ss_pred             eeecCCCCCCCC
Q psy13443         78 TYMCYLCNYHTP   89 (188)
Q Consensus        78 ~~~C~~C~~~f~   89 (188)
                      .+.|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            456777775444


No 180
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=43.26  E-value=5.7  Score=26.39  Aligned_cols=16  Identities=13%  Similarity=0.123  Sum_probs=10.3

Q ss_pred             eecccCccccCCchhH
Q psy13443        107 FRCALCAYSARRKTHL  122 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l  122 (188)
                      -.|..|++.|.+...+
T Consensus        29 ReC~~C~~RFTTyErv   44 (147)
T TIGR00244        29 RECLECHERFTTFERA   44 (147)
T ss_pred             ccCCccCCccceeeec
Confidence            4577777777766544


No 181
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=42.72  E-value=17  Score=23.07  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=5.7

Q ss_pred             eecCCCCCCCC
Q psy13443         79 YMCYLCNYHTP   89 (188)
Q Consensus        79 ~~C~~C~~~f~   89 (188)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            45555554444


No 182
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=42.40  E-value=4.8  Score=33.79  Aligned_cols=74  Identities=20%  Similarity=0.441  Sum_probs=42.7

Q ss_pred             ccccccccccCCCCcee-----ecCCCCCCCCCHHHHHHHHHhcCCCCce-ecccCccccCCchhHHHHHHhhcCCCCcc
Q psy13443         63 HCATCVDMVRPDASYTY-----MCYLCNYHTPTRKYMRTHIDTHNGEKPF-RCALCAYSARRKTHLDDHMRRHTGEKPHA  136 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~-----~C~~C~~~f~~~~~l~~H~~~h~~~~~~-~C~~C~~~~~~~~~l~~H~~~h~~~~~~~  136 (188)
                      .|..|.+-+....++.|     .|..||-.|+--..|--- +-.+.-+.| -|+.|.+.|....+-+.|      ..|..
T Consensus       103 ~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~a  175 (750)
T COG0068         103 TCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIA  175 (750)
T ss_pred             hhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccccc------ccccc
Confidence            67777666665555433     388888777644332211 122222223 488888888887664443      24678


Q ss_pred             CCCCccc
Q psy13443        137 CGMCGYE  143 (188)
Q Consensus       137 C~~C~~~  143 (188)
                      |+.||..
T Consensus       176 Cp~CGP~  182 (750)
T COG0068         176 CPKCGPH  182 (750)
T ss_pred             CcccCCC
Confidence            8888864


No 183
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=41.81  E-value=14  Score=26.33  Aligned_cols=12  Identities=33%  Similarity=0.584  Sum_probs=7.0

Q ss_pred             HHHHHHHHHhcC
Q psy13443        148 SQLMQHLRKVHK  159 (188)
Q Consensus       148 ~~l~~H~~~~h~  159 (188)
                      ..|.+|+|.|.+
T Consensus       131 GLLLRhLRHHSN  142 (238)
T PF02084_consen  131 GLLLRHLRHHSN  142 (238)
T ss_pred             HHHHHHHHHHHH
Confidence            455666665554


No 184
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=41.50  E-value=2.8  Score=35.11  Aligned_cols=33  Identities=21%  Similarity=0.466  Sum_probs=22.6

Q ss_pred             ecCCCCCCCCCHHHHHHHHHhcCCCCceecccCccccCC
Q psy13443         80 MCYLCNYHTPTRKYMRTHIDTHNGEKPFRCALCAYSARR  118 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~  118 (188)
                      .|+.|.+.+..+.+..-    |.  .|..|+.||-....
T Consensus       153 lC~~C~~EY~dP~nRRf----HA--Qp~aCp~CGP~~~l  185 (750)
T COG0068         153 LCPFCDKEYKDPLNRRF----HA--QPIACPKCGPHLFL  185 (750)
T ss_pred             CCHHHHHHhcCcccccc----cc--ccccCcccCCCeEE
Confidence            58999888877765333    32  36799999975433


No 185
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=41.39  E-value=9.5  Score=19.36  Aligned_cols=15  Identities=20%  Similarity=0.432  Sum_probs=9.3

Q ss_pred             CccccCCCcccccCH
Q psy13443         12 QQFECDFCPYGAKQA   26 (188)
Q Consensus        12 ~~~~C~~C~~~f~~~   26 (188)
                      .|+.|+.|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578999999988743


No 186
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=41.27  E-value=15  Score=20.62  Aligned_cols=6  Identities=33%  Similarity=0.960  Sum_probs=1.5

Q ss_pred             ecCCCC
Q psy13443         80 MCYLCN   85 (188)
Q Consensus        80 ~C~~C~   85 (188)
                      .|..||
T Consensus        27 hCr~CG   32 (69)
T PF01363_consen   27 HCRNCG   32 (69)
T ss_dssp             E-TTT-
T ss_pred             ccCCCC
Confidence            333333


No 187
>KOG1701|consensus
Probab=41.12  E-value=24  Score=27.87  Aligned_cols=13  Identities=15%  Similarity=0.526  Sum_probs=9.0

Q ss_pred             ceecccCccccCC
Q psy13443        106 PFRCALCAYSARR  118 (188)
Q Consensus       106 ~~~C~~C~~~~~~  118 (188)
                      =|+|..|+...+.
T Consensus       427 CY~CEDCg~~LS~  439 (468)
T KOG1701|consen  427 CYKCEDCGLLLSS  439 (468)
T ss_pred             ceehhhcCccccc
Confidence            4778888876654


No 188
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=41.11  E-value=6.3  Score=22.62  Aligned_cols=30  Identities=20%  Similarity=0.431  Sum_probs=13.3

Q ss_pred             ceecccCccccCCchhHHHHHHhhcCCCCccCCCCccc
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYE  143 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  143 (188)
                      ...|..|+........       ..+ ..+.|+.|+..
T Consensus        41 ~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~   70 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEY-------SCG-ADYFCPICGLY   70 (71)
T ss_dssp             EEEETTT--EEES-SB-------TT---SEEETTTTEE
T ss_pred             CeECCCCCCccChhhh-------hcC-CCccCcCcCCC
Confidence            4566666655444332       111 34666666644


No 189
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=41.05  E-value=13  Score=24.16  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=7.0

Q ss_pred             CccCCCCccccc
Q psy13443        134 PHACGMCGYECA  145 (188)
Q Consensus       134 ~~~C~~C~~~f~  145 (188)
                      .|+|..|++.|.
T Consensus        53 RyrC~~C~~tf~   64 (129)
T COG3677          53 RYKCKSCGSTFT   64 (129)
T ss_pred             ccccCCcCccee
Confidence            456666666554


No 190
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.71  E-value=17  Score=22.80  Aligned_cols=12  Identities=17%  Similarity=0.152  Sum_probs=7.7

Q ss_pred             CceecccCcccc
Q psy13443        105 KPFRCALCAYSA  116 (188)
Q Consensus       105 ~~~~C~~C~~~~  116 (188)
                      .|..|+.||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            456666666666


No 191
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=40.59  E-value=27  Score=18.60  Aligned_cols=11  Identities=27%  Similarity=0.700  Sum_probs=3.9

Q ss_pred             ecccCccccCC
Q psy13443        108 RCALCAYSARR  118 (188)
Q Consensus       108 ~C~~C~~~~~~  118 (188)
                      .||+|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            56666655543


No 192
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=39.61  E-value=24  Score=21.48  Aligned_cols=8  Identities=63%  Similarity=1.526  Sum_probs=5.0

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      |.|..||.
T Consensus         5 F~C~~CG~   12 (92)
T PF12647_consen    5 FTCVHCGL   12 (92)
T ss_pred             cCccccCC
Confidence            56666665


No 193
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=39.59  E-value=17  Score=21.99  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=7.0

Q ss_pred             cccCCCCCC
Q psy13443         41 NFVCVHCKQ   49 (188)
Q Consensus        41 ~~~C~~C~~   49 (188)
                      .|.|+.|++
T Consensus        36 ~y~CpfCgk   44 (90)
T PRK03976         36 KHVCPVCGR   44 (90)
T ss_pred             CccCCCCCC
Confidence            488888876


No 194
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=38.64  E-value=45  Score=28.26  Aligned_cols=24  Identities=29%  Similarity=0.490  Sum_probs=10.7

Q ss_pred             ccccccccccCCCCceeecCCCCCCCC
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYHTP   89 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~f~   89 (188)
                      .|+.||.......   --|+.||....
T Consensus        29 ~Cp~CG~~~~~~~---~fC~~CG~~~~   52 (645)
T PRK14559         29 PCPQCGTEVPVDE---AHCPNCGAETG   52 (645)
T ss_pred             cCCCCCCCCCccc---ccccccCCccc
Confidence            3555555543211   23555554443


No 195
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=38.42  E-value=16  Score=27.68  Aligned_cols=13  Identities=31%  Similarity=0.682  Sum_probs=7.9

Q ss_pred             CccCCCCcccccC
Q psy13443        134 PHACGMCGYECAQ  146 (188)
Q Consensus       134 ~~~C~~C~~~f~~  146 (188)
                      ...|..|+...+.
T Consensus       252 ~e~C~~C~~YlK~  264 (309)
T PRK03564        252 AESCGDCGTYLKI  264 (309)
T ss_pred             eeeccccccccee
Confidence            3567777765544


No 196
>KOG4377|consensus
Probab=37.79  E-value=53  Score=25.96  Aligned_cols=21  Identities=29%  Similarity=0.290  Sum_probs=17.8

Q ss_pred             CCcccccCcHHHHHHHHHhcC
Q psy13443        139 MCGYECAQGSQLMQHLRKVHK  159 (188)
Q Consensus       139 ~C~~~f~~~~~l~~H~~~~h~  159 (188)
                      .|+.++.+.+++..|.|.|-.
T Consensus       408 Gc~~tl~s~sqm~shkrkheR  428 (480)
T KOG4377|consen  408 GCEATLYSVSQMASHKRKHER  428 (480)
T ss_pred             CCceEEEehhhhhhhhhhhhh
Confidence            488999999999999887764


No 197
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=37.76  E-value=27  Score=24.09  Aligned_cols=17  Identities=12%  Similarity=0.282  Sum_probs=8.2

Q ss_pred             CCCceecccCccccCCc
Q psy13443        103 GEKPFRCALCAYSARRK  119 (188)
Q Consensus       103 ~~~~~~C~~C~~~~~~~  119 (188)
                      ...-|.|+.|...|+..
T Consensus       110 ~~~~y~C~~~~~r~sfd  126 (176)
T COG1675         110 ENNYYVCPNCHVKYSFD  126 (176)
T ss_pred             cCCceeCCCCCCcccHH
Confidence            33445555555444443


No 198
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=37.45  E-value=24  Score=23.81  Aligned_cols=26  Identities=31%  Similarity=0.611  Sum_probs=17.2

Q ss_pred             ccccccccccCCCCceeecCCCCCCC
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYHT   88 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~f   88 (188)
                      .|+.|.+.+...+...|.|..|+..+
T Consensus        36 aC~~C~kkv~~~~~~~~~C~~C~~~~   61 (166)
T cd04476          36 ACPGCNKKVVEEGNGTYRCEKCNKSV   61 (166)
T ss_pred             cccccCcccEeCCCCcEECCCCCCcC
Confidence            56666666655444668888888765


No 199
>PRK10220 hypothetical protein; Provisional
Probab=37.16  E-value=29  Score=21.79  Aligned_cols=15  Identities=20%  Similarity=0.350  Sum_probs=8.9

Q ss_pred             ceeecCCCCCCCCCH
Q psy13443         77 YTYMCYLCNYHTPTR   91 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~   91 (188)
                      ..|.|+.|+..+...
T Consensus        19 ~~~vCpeC~hEW~~~   33 (111)
T PRK10220         19 GMYICPECAHEWNDA   33 (111)
T ss_pred             CeEECCcccCcCCcc
Confidence            346677777655543


No 200
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.11  E-value=18  Score=23.08  Aligned_cols=16  Identities=13%  Similarity=0.171  Sum_probs=9.9

Q ss_pred             CceeecCCCCCCCCCH
Q psy13443         76 SYTYMCYLCNYHTPTR   91 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~   91 (188)
                      +..+.|..|+..|...
T Consensus        69 p~~~~C~~Cg~~~~~~   84 (117)
T PRK00564         69 KVELECKDCSHVFKPN   84 (117)
T ss_pred             CCEEEhhhCCCccccC
Confidence            3346777777666543


No 201
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.84  E-value=17  Score=23.85  Aligned_cols=16  Identities=13%  Similarity=0.262  Sum_probs=10.4

Q ss_pred             CceeecCCCCCCCCCH
Q psy13443         76 SYTYMCYLCNYHTPTR   91 (188)
Q Consensus        76 ~~~~~C~~C~~~f~~~   91 (188)
                      +..+.|..|+..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            4557777777666543


No 202
>COG1773 Rubredoxin [Energy production and conversion]
Probab=36.76  E-value=17  Score=19.74  Aligned_cols=15  Identities=27%  Similarity=0.855  Sum_probs=11.9

Q ss_pred             ceecccCccccCCch
Q psy13443        106 PFRCALCAYSARRKT  120 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~  120 (188)
                      .|+|.+||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            589999999886653


No 203
>KOG4124|consensus
Probab=36.60  E-value=4.6  Score=30.80  Aligned_cols=50  Identities=24%  Similarity=0.517  Sum_probs=36.4

Q ss_pred             Cceeccc--CccccCCchhHHHHHHhhc-------------------CCCCccCCCCcccccCcHHHHHHH
Q psy13443        105 KPFRCAL--CAYSARRKTHLDDHMRRHT-------------------GEKPHACGMCGYECAQGSQLMQHL  154 (188)
Q Consensus       105 ~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~  154 (188)
                      ++|.|++  |.+.+.....|..|...-+                   ..|||+|++|.+.++.-..|..|.
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            5688866  8888888878777764321                   257899999999888766665554


No 204
>KOG1842|consensus
Probab=36.56  E-value=21  Score=28.36  Aligned_cols=28  Identities=25%  Similarity=0.343  Sum_probs=19.1

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhcCCC
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVHKVD  161 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~  161 (188)
                      .|.|++|...|.+...|..|+..-|+..
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            3677777777777777777776666443


No 205
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=36.54  E-value=24  Score=17.02  Aligned_cols=9  Identities=22%  Similarity=0.947  Sum_probs=4.8

Q ss_pred             eeecCCCCC
Q psy13443         78 TYMCYLCNY   86 (188)
Q Consensus        78 ~~~C~~C~~   86 (188)
                      .+.|+.|+.
T Consensus        22 R~vC~~Cg~   30 (34)
T PF14803_consen   22 RLVCPACGF   30 (34)
T ss_dssp             EEEETTTTE
T ss_pred             ceECCCCCC
Confidence            355666653


No 206
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.47  E-value=9.4  Score=22.16  Aligned_cols=28  Identities=25%  Similarity=0.510  Sum_probs=15.4

Q ss_pred             cccCCCcccccCHHHHHHHHHhhhcCCc-ccCCCCCC
Q psy13443         14 FECDFCPYGAKQAADVHNHVQQIHMGVN-FVCVHCKQ   49 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~-~~C~~C~~   49 (188)
                      |.|..|+..|    .+.+++    .+-| -.|+.|+.
T Consensus        13 Y~c~~cg~~~----dvvq~~----~ddplt~ce~c~a   41 (82)
T COG2331          13 YECTECGNRF----DVVQAM----TDDPLTTCEECGA   41 (82)
T ss_pred             EeecccchHH----HHHHhc----ccCccccChhhCh
Confidence            6777777764    344343    2223 45666665


No 207
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=36.33  E-value=26  Score=21.01  Aligned_cols=13  Identities=15%  Similarity=0.363  Sum_probs=8.2

Q ss_pred             ceeecCCCCCCCC
Q psy13443         77 YTYMCYLCNYHTP   89 (188)
Q Consensus        77 ~~~~C~~C~~~f~   89 (188)
                      .-+.|..|+..|.
T Consensus        52 GIW~C~kCg~~fA   64 (89)
T COG1997          52 GIWKCRKCGAKFA   64 (89)
T ss_pred             CeEEcCCCCCeec
Confidence            3466777776664


No 208
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=35.33  E-value=12  Score=26.19  Aligned_cols=24  Identities=21%  Similarity=0.513  Sum_probs=0.0

Q ss_pred             CCccccCCCccc-ccCHHHHHHHHH
Q psy13443         11 KQQFECDFCPYG-AKQAADVHNHVQ   34 (188)
Q Consensus        11 ~~~~~C~~C~~~-f~~~~~l~~H~~   34 (188)
                      ...|.|.+||.. |.-+..+..|+.
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            456888888853 556777777763


No 209
>KOG4167|consensus
Probab=34.95  E-value=9.1  Score=32.33  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=22.8

Q ss_pred             ceecccCccccCCchhHHHHHHhhc
Q psy13443        106 PFRCALCAYSARRKTHLDDHMRRHT  130 (188)
Q Consensus       106 ~~~C~~C~~~~~~~~~l~~H~~~h~  130 (188)
                      -|.|..|++.|....++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3899999999999999999999985


No 210
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=34.62  E-value=11  Score=22.86  Aligned_cols=9  Identities=22%  Similarity=1.014  Sum_probs=6.9

Q ss_pred             cccCCCCCC
Q psy13443         41 NFVCVHCKQ   49 (188)
Q Consensus        41 ~~~C~~C~~   49 (188)
                      +|.|+.|++
T Consensus        35 ky~Cp~Cgk   43 (90)
T PF01780_consen   35 KYTCPFCGK   43 (90)
T ss_dssp             -BEESSSSS
T ss_pred             CCcCCCCCC
Confidence            488888887


No 211
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=34.60  E-value=24  Score=22.08  Aligned_cols=13  Identities=23%  Similarity=0.539  Sum_probs=7.9

Q ss_pred             eeecCCCCCCCCC
Q psy13443         78 TYMCYLCNYHTPT   90 (188)
Q Consensus        78 ~~~C~~C~~~f~~   90 (188)
                      .|.|+.|+.....
T Consensus        19 ~~iCpeC~~EW~~   31 (109)
T TIGR00686        19 QLICPSCLYEWNE   31 (109)
T ss_pred             eeECccccccccc
Confidence            4667777665543


No 212
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=33.82  E-value=40  Score=18.36  Aligned_cols=11  Identities=27%  Similarity=0.640  Sum_probs=5.8

Q ss_pred             CCccCCCCccc
Q psy13443        133 KPHACGMCGYE  143 (188)
Q Consensus       133 ~~~~C~~C~~~  143 (188)
                      ..|.|+.||..
T Consensus        13 v~~~Cp~cGip   23 (55)
T PF13824_consen   13 VNFECPDCGIP   23 (55)
T ss_pred             cCCcCCCCCCc
Confidence            34556666544


No 213
>KOG2272|consensus
Probab=33.38  E-value=6.1  Score=28.72  Aligned_cols=43  Identities=21%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             ccCCCCCC-cccccccccccccccccccccccCCCCceeecCCC
Q psy13443         42 FVCVHCKQ-FEVVPTRKTQTLEHCATCVDMVRPDASYTYMCYLC   84 (188)
Q Consensus        42 ~~C~~C~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~C~~C   84 (188)
                      |.|..|++ ..+..-++......|..|.......+...|.|..|
T Consensus       100 F~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KC  143 (332)
T KOG2272|consen  100 FRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKC  143 (332)
T ss_pred             chhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhh
Confidence            66666655 44433334444444444444433333333333333


No 214
>PF14369 zf-RING_3:  zinc-finger
Probab=33.33  E-value=27  Score=16.93  Aligned_cols=8  Identities=25%  Similarity=0.471  Sum_probs=3.4

Q ss_pred             cCCCCCCC
Q psy13443         81 CYLCNYHT   88 (188)
Q Consensus        81 C~~C~~~f   88 (188)
                      |+.|+-+|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            44444333


No 215
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=33.32  E-value=4  Score=19.88  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=5.6

Q ss_pred             CccCCCCccccc
Q psy13443        134 PHACGMCGYECA  145 (188)
Q Consensus       134 ~~~C~~C~~~f~  145 (188)
                      +..|..||-.+.
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            456777776553


No 216
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=33.31  E-value=29  Score=16.76  Aligned_cols=6  Identities=33%  Similarity=1.160  Sum_probs=1.4

Q ss_pred             CCCCCC
Q psy13443         44 CVHCKQ   49 (188)
Q Consensus        44 C~~C~~   49 (188)
                      |..|++
T Consensus         6 C~eC~~   11 (34)
T PF01286_consen    6 CDECGK   11 (34)
T ss_dssp             -TTT--
T ss_pred             HhHhCC
Confidence            444444


No 217
>PRK05978 hypothetical protein; Provisional
Probab=33.26  E-value=31  Score=23.08  Aligned_cols=8  Identities=25%  Similarity=0.575  Sum_probs=5.9

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      -+|+.|++
T Consensus        34 grCP~CG~   41 (148)
T PRK05978         34 GRCPACGE   41 (148)
T ss_pred             CcCCCCCC
Confidence            47888876


No 218
>KOG0717|consensus
Probab=33.11  E-value=27  Score=27.98  Aligned_cols=34  Identities=18%  Similarity=0.316  Sum_probs=25.6

Q ss_pred             ccCCCCcccccCcHHHHHHHH-HhcCCCCCCCCcc
Q psy13443        135 HACGMCGYECAQGSQLMQHLR-KVHKVDKKGGEEE  168 (188)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~-~~h~~~~~~~~~~  168 (188)
                      ..|.-|+..|.+..-|..|+. +.|+.-+......
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~tgHa~~~~~sk~~  495 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKKTGHARLPSKSKPN  495 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhhcCCeeccccCCcc
Confidence            579999999999999999985 4666555544433


No 219
>KOG0717|consensus
Probab=33.01  E-value=31  Score=27.66  Aligned_cols=22  Identities=23%  Similarity=0.585  Sum_probs=20.2

Q ss_pred             eecCCCCCCCCCHHHHHHHHHh
Q psy13443         79 YMCYLCNYHTPTRKYMRTHIDT  100 (188)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~  100 (188)
                      +.|..|+++|.+-..+.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999864


No 220
>PRK12496 hypothetical protein; Provisional
Probab=32.98  E-value=23  Score=24.08  Aligned_cols=11  Identities=27%  Similarity=0.637  Sum_probs=7.8

Q ss_pred             eecCCCCCCCC
Q psy13443         79 YMCYLCNYHTP   89 (188)
Q Consensus        79 ~~C~~C~~~f~   89 (188)
                      |.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            66777777765


No 221
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=32.84  E-value=33  Score=17.93  Aligned_cols=11  Identities=27%  Similarity=0.733  Sum_probs=5.7

Q ss_pred             CceeecCCCCC
Q psy13443         76 SYTYMCYLCNY   86 (188)
Q Consensus        76 ~~~~~C~~C~~   86 (188)
                      ...|.|..|+.
T Consensus        26 ~~g~~C~~C~~   36 (53)
T PF00130_consen   26 KQGYRCSWCGL   36 (53)
T ss_dssp             SCEEEETTTT-
T ss_pred             CCeEEECCCCC
Confidence            34466666653


No 222
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=32.57  E-value=45  Score=23.41  Aligned_cols=11  Identities=27%  Similarity=0.510  Sum_probs=6.6

Q ss_pred             CccCCCCcccc
Q psy13443        134 PHACGMCGYEC  144 (188)
Q Consensus       134 ~~~C~~C~~~f  144 (188)
                      .+.|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            35666666655


No 223
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=32.27  E-value=32  Score=18.27  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=3.7

Q ss_pred             cCCCCCCCC
Q psy13443         81 CYLCNYHTP   89 (188)
Q Consensus        81 C~~C~~~f~   89 (188)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            344444443


No 224
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=32.09  E-value=34  Score=22.63  Aligned_cols=11  Identities=27%  Similarity=0.615  Sum_probs=5.5

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            45555555443


No 225
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=32.07  E-value=16  Score=24.08  Aligned_cols=26  Identities=27%  Similarity=0.623  Sum_probs=14.0

Q ss_pred             ccc--cccccccCCCCceeecCCCCCCC
Q psy13443         63 HCA--TCVDMVRPDASYTYMCYLCNYHT   88 (188)
Q Consensus        63 ~c~--~c~~~~~~~~~~~~~C~~C~~~f   88 (188)
                      .|+  .|.+.+...+...|.|+.|++..
T Consensus        20 aC~~~~C~kKv~~~~~~~y~C~~C~~~~   47 (146)
T PF08646_consen   20 ACPNEKCNKKVTENGDGSYRCEKCNKTV   47 (146)
T ss_dssp             E-TSTTTS-B-EEETTTEEEETTTTEEE
T ss_pred             CCCCccCCCEeecCCCcEEECCCCCCcC
Confidence            455  55555554545567777777654


No 226
>KOG4727|consensus
Probab=31.88  E-value=33  Score=23.48  Aligned_cols=24  Identities=25%  Similarity=0.609  Sum_probs=21.1

Q ss_pred             CCccccCCCcccccCHHHHHHHHH
Q psy13443         11 KQQFECDFCPYGAKQAADVHNHVQ   34 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~H~~   34 (188)
                      ...|-|.+|.-.|.+..++..|+.
T Consensus        73 ~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   73 KGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             cCceeeeecceeehhhHHHHHHhc
Confidence            346999999999999999999983


No 227
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=31.68  E-value=33  Score=26.42  Aligned_cols=27  Identities=26%  Similarity=0.495  Sum_probs=18.8

Q ss_pred             hccCCCccccCCCc-ccccCHHHHHHHH
Q psy13443          7 THLAKQQFECDFCP-YGAKQAADVHNHV   33 (188)
Q Consensus         7 ~h~~~~~~~C~~C~-~~f~~~~~l~~H~   33 (188)
                      .|.-++.|.|.+|| +.+..+..+.+|+
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhh
Confidence            34446678888888 6667777777776


No 228
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=31.45  E-value=40  Score=15.46  Aligned_cols=8  Identities=38%  Similarity=0.866  Sum_probs=5.2

Q ss_pred             eeecCCCC
Q psy13443         78 TYMCYLCN   85 (188)
Q Consensus        78 ~~~C~~C~   85 (188)
                      .|.|..|.
T Consensus        15 ~Y~C~~c~   22 (30)
T PF03107_consen   15 FYHCSECC   22 (30)
T ss_pred             eEEeCCCC
Confidence            56676666


No 229
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=31.45  E-value=41  Score=21.36  Aligned_cols=16  Identities=19%  Similarity=0.551  Sum_probs=11.3

Q ss_pred             CCccccCCCcccccCH
Q psy13443         11 KQQFECDFCPYGAKQA   26 (188)
Q Consensus        11 ~~~~~C~~C~~~f~~~   26 (188)
                      ...+.|..||..+...
T Consensus        20 ~~~l~C~kCgye~~~~   35 (113)
T COG1594          20 GGKLVCRKCGYEEEAS   35 (113)
T ss_pred             CcEEECCCCCcchhcc
Confidence            3468899999775544


No 230
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=31.40  E-value=8.5  Score=24.35  Aligned_cols=14  Identities=14%  Similarity=0.211  Sum_probs=8.0

Q ss_pred             eeecCCCCCCCCCH
Q psy13443         78 TYMCYLCNYHTPTR   91 (188)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (188)
                      .+.|..|+..|...
T Consensus        70 ~~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   70 RARCRDCGHEFEPD   83 (113)
T ss_dssp             EEEETTTS-EEECH
T ss_pred             cEECCCCCCEEecC
Confidence            35677777666544


No 231
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=31.35  E-value=49  Score=24.82  Aligned_cols=26  Identities=27%  Similarity=0.401  Sum_probs=19.2

Q ss_pred             CCccCCCCcccccCcHHHHHHHHHhc
Q psy13443        133 KPHACGMCGYECAQGSQLMQHLRKVH  158 (188)
Q Consensus       133 ~~~~C~~C~~~f~~~~~l~~H~~~~h  158 (188)
                      .-|.|..|-+.|.+...|.+|+....
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHHhCC
Confidence            44778888888888888888876544


No 232
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=31.32  E-value=64  Score=17.48  Aligned_cols=8  Identities=25%  Similarity=0.658  Sum_probs=4.4

Q ss_pred             eecCCCCC
Q psy13443         79 YMCYLCNY   86 (188)
Q Consensus        79 ~~C~~C~~   86 (188)
                      ..|+.|+.
T Consensus        22 VvCp~Cga   29 (54)
T PF14446_consen   22 VVCPECGA   29 (54)
T ss_pred             EECCCCCC
Confidence            45666653


No 233
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.00  E-value=41  Score=25.15  Aligned_cols=11  Identities=27%  Similarity=0.709  Sum_probs=5.4

Q ss_pred             eecccCccccC
Q psy13443        107 FRCALCAYSAR  117 (188)
Q Consensus       107 ~~C~~C~~~~~  117 (188)
                      |.|++|...|.
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            45555554443


No 234
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=30.82  E-value=44  Score=20.57  Aligned_cols=36  Identities=28%  Similarity=0.518  Sum_probs=18.7

Q ss_pred             eecccCccccCCchhHHHHHHhhcCC---CCccCCCCccccc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTGE---KPHACGMCGYECA  145 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~~---~~~~C~~C~~~f~  145 (188)
                      ..|+.||..-.....++  ++. ..+   ..|.|..|++.++
T Consensus        63 ~~Cp~Cg~~~a~f~~~Q--~Rs-adE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        63 VECPKCGHKEAYYWLLQ--TRR-ADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             CCCCCCCCCeeEEEEec--cCC-CCCCcEEEEEeCCCCCeeE
Confidence            57888875543333221  111 111   1278888887654


No 235
>KOG2636|consensus
Probab=30.81  E-value=48  Score=26.49  Aligned_cols=23  Identities=22%  Similarity=0.749  Sum_probs=14.2

Q ss_pred             CceecccCc-cccCCchhHHHHHH
Q psy13443        105 KPFRCALCA-YSARRKTHLDDHMR  127 (188)
Q Consensus       105 ~~~~C~~C~-~~~~~~~~l~~H~~  127 (188)
                      ..|.|.+|| +++.....+.+|..
T Consensus       400 ~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  400 IEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cccceeeccCccccCcHHHHHHhH
Confidence            346666666 66666666666654


No 236
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=30.43  E-value=36  Score=18.54  Aligned_cols=13  Identities=8%  Similarity=-0.064  Sum_probs=5.2

Q ss_pred             ceeecCCCCCCCC
Q psy13443         77 YTYMCYLCNYHTP   89 (188)
Q Consensus        77 ~~~~C~~C~~~f~   89 (188)
                      .|.....|+..|.
T Consensus        23 ~PV~s~~C~H~fe   35 (57)
T PF11789_consen   23 DPVKSKKCGHTFE   35 (57)
T ss_dssp             SEEEESSS--EEE
T ss_pred             CCcCcCCCCCeec
Confidence            3444455554444


No 237
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=30.32  E-value=7.7  Score=17.84  Aligned_cols=9  Identities=22%  Similarity=0.563  Sum_probs=5.0

Q ss_pred             ecccCcccc
Q psy13443        108 RCALCAYSA  116 (188)
Q Consensus       108 ~C~~C~~~~  116 (188)
                      .|..|+..|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455555555


No 238
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=30.12  E-value=18  Score=18.22  Aligned_cols=11  Identities=36%  Similarity=0.954  Sum_probs=7.4

Q ss_pred             CccCCCCcccc
Q psy13443        134 PHACGMCGYEC  144 (188)
Q Consensus       134 ~~~C~~C~~~f  144 (188)
                      +..|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45777777665


No 239
>PHA02998 RNA polymerase subunit; Provisional
Probab=30.11  E-value=58  Score=22.55  Aligned_cols=14  Identities=21%  Similarity=0.363  Sum_probs=9.0

Q ss_pred             eeecCCCCCCCCCH
Q psy13443         78 TYMCYLCNYHTPTR   91 (188)
Q Consensus        78 ~~~C~~C~~~f~~~   91 (188)
                      .|.|..|+..|.-+
T Consensus       171 FYkC~~CG~~wkpp  184 (195)
T PHA02998        171 RHACRDCKKHFKPP  184 (195)
T ss_pred             EEEcCCCCCccCCc
Confidence            46777777766543


No 240
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=29.91  E-value=22  Score=17.47  Aligned_cols=11  Identities=18%  Similarity=0.664  Sum_probs=5.3

Q ss_pred             ccccCCCcccc
Q psy13443         13 QFECDFCPYGA   23 (188)
Q Consensus        13 ~~~C~~C~~~f   23 (188)
                      .|+|+.||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            57777777653


No 241
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=29.80  E-value=18  Score=17.72  Aligned_cols=13  Identities=31%  Similarity=0.956  Sum_probs=5.5

Q ss_pred             hcCCCCceecccC
Q psy13443        100 THNGEKPFRCALC  112 (188)
Q Consensus       100 ~h~~~~~~~C~~C  112 (188)
                      ...|...|+|..|
T Consensus        23 ~~~G~qryrC~~C   35 (36)
T PF03811_consen   23 SPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCEeEecCcC
Confidence            3333334454444


No 242
>PLN02294 cytochrome c oxidase subunit Vb
Probab=29.79  E-value=28  Score=23.84  Aligned_cols=16  Identities=19%  Similarity=0.355  Sum_probs=13.0

Q ss_pred             CCCccCCCCcccccCc
Q psy13443        132 EKPHACGMCGYECAQG  147 (188)
Q Consensus       132 ~~~~~C~~C~~~f~~~  147 (188)
                      .+|.+|+.||..|.-.
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4789999999988643


No 243
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=29.59  E-value=39  Score=17.00  Aligned_cols=7  Identities=29%  Similarity=0.942  Sum_probs=3.9

Q ss_pred             cCCCCCC
Q psy13443         43 VCVHCKQ   49 (188)
Q Consensus        43 ~C~~C~~   49 (188)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555554


No 244
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=29.28  E-value=29  Score=21.40  Aligned_cols=13  Identities=38%  Similarity=0.807  Sum_probs=8.1

Q ss_pred             CCccCCCCccccc
Q psy13443        133 KPHACGMCGYECA  145 (188)
Q Consensus       133 ~~~~C~~C~~~f~  145 (188)
                      +|.+|..||..|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            5666666666654


No 245
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=28.98  E-value=36  Score=22.63  Aligned_cols=11  Identities=18%  Similarity=0.301  Sum_probs=5.3

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      .+.|+.|++.|
T Consensus       124 f~~C~~C~kiy  134 (147)
T PF01927_consen  124 FWRCPGCGKIY  134 (147)
T ss_pred             EEECCCCCCEe
Confidence            34555555443


No 246
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=28.96  E-value=21  Score=23.76  Aligned_cols=11  Identities=27%  Similarity=0.637  Sum_probs=5.5

Q ss_pred             eeecCCCCCCC
Q psy13443         78 TYMCYLCNYHT   88 (188)
Q Consensus        78 ~~~C~~C~~~f   88 (188)
                      .|.|..|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            35555555443


No 247
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=28.82  E-value=23  Score=26.82  Aligned_cols=12  Identities=25%  Similarity=0.451  Sum_probs=7.3

Q ss_pred             CCceeecCCCCC
Q psy13443         75 ASYTYMCYLCNY   86 (188)
Q Consensus        75 ~~~~~~C~~C~~   86 (188)
                      +.+-..|+.|+.
T Consensus       207 G~RyL~CslC~t  218 (305)
T TIGR01562       207 GLRYLSCSLCAT  218 (305)
T ss_pred             CceEEEcCCCCC
Confidence            345566777764


No 248
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=28.80  E-value=39  Score=16.20  Aligned_cols=21  Identities=14%  Similarity=0.319  Sum_probs=11.0

Q ss_pred             eeecCCCCCCCCCHHHHHHHHH
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHID   99 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~   99 (188)
                      .+.|+.|++.+. .+.+..|+.
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHH
Confidence            356777776544 334555654


No 249
>KOG3507|consensus
Probab=28.68  E-value=34  Score=18.80  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=5.0

Q ss_pred             ceecccCccc
Q psy13443        106 PFRCALCAYS  115 (188)
Q Consensus       106 ~~~C~~C~~~  115 (188)
                      +++|..||..
T Consensus        37 ~irCReCG~R   46 (62)
T KOG3507|consen   37 VIRCRECGYR   46 (62)
T ss_pred             cEehhhcchH
Confidence            4555555543


No 250
>PRK04351 hypothetical protein; Provisional
Probab=28.63  E-value=33  Score=23.00  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=5.3

Q ss_pred             ceecccCcccc
Q psy13443        106 PFRCALCAYSA  116 (188)
Q Consensus       106 ~~~C~~C~~~~  116 (188)
                      .|.|..|+..+
T Consensus       132 ~yrCg~C~g~L  142 (149)
T PRK04351        132 RYRCGKCRGKL  142 (149)
T ss_pred             cEEeCCCCcEe
Confidence            35555555443


No 251
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=28.35  E-value=45  Score=16.97  Aligned_cols=16  Identities=13%  Similarity=0.125  Sum_probs=12.9

Q ss_pred             ccCCCcccccCHHHHH
Q psy13443         15 ECDFCPYGAKQAADVH   30 (188)
Q Consensus        15 ~C~~C~~~f~~~~~l~   30 (188)
                      .|..|+..|.-+....
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            6999999998776654


No 252
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=28.34  E-value=33  Score=16.72  Aligned_cols=9  Identities=22%  Similarity=0.231  Sum_probs=4.3

Q ss_pred             ccCCCcccc
Q psy13443         15 ECDFCPYGA   23 (188)
Q Consensus        15 ~C~~C~~~f   23 (188)
                      .|+.||..|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            344555544


No 253
>KOG0320|consensus
Probab=28.22  E-value=11  Score=26.02  Aligned_cols=7  Identities=29%  Similarity=0.966  Sum_probs=3.8

Q ss_pred             ccCCCCC
Q psy13443         42 FVCVHCK   48 (188)
Q Consensus        42 ~~C~~C~   48 (188)
                      |.|++|-
T Consensus       132 ~~CPiCl  138 (187)
T KOG0320|consen  132 YKCPICL  138 (187)
T ss_pred             cCCCcee
Confidence            5555553


No 254
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.13  E-value=14  Score=23.74  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=6.0

Q ss_pred             eecCCCCCCCCCH
Q psy13443         79 YMCYLCNYHTPTR   91 (188)
Q Consensus        79 ~~C~~C~~~f~~~   91 (188)
                      --|..||..|++.
T Consensus        69 sfchncgs~fpwt   81 (160)
T COG4306          69 SFCHNCGSRFPWT   81 (160)
T ss_pred             chhhcCCCCCCcH
Confidence            3344555544443


No 255
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=28.07  E-value=28  Score=18.20  Aligned_cols=36  Identities=19%  Similarity=0.547  Sum_probs=18.7

Q ss_pred             eecccCccccCCchhHHHHHHhhcC------CCCccCCCCccc
Q psy13443        107 FRCALCAYSARRKTHLDDHMRRHTG------EKPHACGMCGYE  143 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~l~~H~~~h~~------~~~~~C~~C~~~  143 (188)
                      |.|.+|+..|.-...-.. ..+-.|      ..-|.|+.|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~-~~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPE-NGIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGG-GTB-TT--GGGS-TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCcc-cCcCCCCCHHHCCCCCcCcCCCCc
Confidence            789999988866543111 001111      123899999854


No 256
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=27.95  E-value=30  Score=22.54  Aligned_cols=12  Identities=33%  Similarity=0.814  Sum_probs=6.2

Q ss_pred             ccCCCCcccccC
Q psy13443        135 HACGMCGYECAQ  146 (188)
Q Consensus       135 ~~C~~C~~~f~~  146 (188)
                      .+|..|++.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            445555555544


No 257
>COG2879 Uncharacterized small protein [Function unknown]
Probab=27.86  E-value=73  Score=17.83  Aligned_cols=19  Identities=21%  Similarity=0.259  Sum_probs=14.2

Q ss_pred             CcHHHHHHHHHhcCCCCCC
Q psy13443        146 QGSQLMQHLRKVHKVDKKG  164 (188)
Q Consensus       146 ~~~~l~~H~~~~h~~~~~~  164 (188)
                      .-.....|++.+|+++|+.
T Consensus        24 dYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             cHHHHHHHHHHhCcCCCcc
Confidence            3456778999998888763


No 258
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=27.49  E-value=90  Score=15.44  Aligned_cols=15  Identities=13%  Similarity=0.107  Sum_probs=6.6

Q ss_pred             ecCCCCCCCCCHHHH
Q psy13443         80 MCYLCNYHTPTRKYM   94 (188)
Q Consensus        80 ~C~~C~~~f~~~~~l   94 (188)
                      .|+.|+-.+.....|
T Consensus        21 ~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   21 VCPSCGGIWFDAGEL   35 (41)
T ss_pred             ECCCCCeEEccHHHH
Confidence            444444444444333


No 259
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=27.44  E-value=30  Score=23.13  Aligned_cols=7  Identities=29%  Similarity=0.975  Sum_probs=3.2

Q ss_pred             eecccCc
Q psy13443        107 FRCALCA  113 (188)
Q Consensus       107 ~~C~~C~  113 (188)
                      |.|..||
T Consensus       113 l~C~~Cg  119 (146)
T PF07295_consen  113 LVCENCG  119 (146)
T ss_pred             EecccCC
Confidence            4444444


No 260
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=27.28  E-value=39  Score=16.49  Aligned_cols=11  Identities=27%  Similarity=0.606  Sum_probs=5.5

Q ss_pred             CCceeecCCCC
Q psy13443         75 ASYTYMCYLCN   85 (188)
Q Consensus        75 ~~~~~~C~~C~   85 (188)
                      .+..|.|..|+
T Consensus        22 ~dG~~yC~~cG   32 (36)
T PF11781_consen   22 DDGFYYCDRCG   32 (36)
T ss_pred             cCCEEEhhhCc
Confidence            34445555555


No 261
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=27.16  E-value=55  Score=16.86  Aligned_cols=14  Identities=21%  Similarity=0.297  Sum_probs=7.5

Q ss_pred             CCceeecCCCCCCC
Q psy13443         75 ASYTYMCYLCNYHT   88 (188)
Q Consensus        75 ~~~~~~C~~C~~~f   88 (188)
                      ......|..|+..|
T Consensus        11 ~~~~i~C~~C~~~~   24 (51)
T PF00628_consen   11 DGDMIQCDSCNRWY   24 (51)
T ss_dssp             TSSEEEBSTTSCEE
T ss_pred             CCCeEEcCCCChhh
Confidence            34445666666544


No 262
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=26.69  E-value=41  Score=17.38  Aligned_cols=6  Identities=50%  Similarity=1.459  Sum_probs=3.1

Q ss_pred             CCCCCC
Q psy13443         44 CVHCKQ   49 (188)
Q Consensus        44 C~~C~~   49 (188)
                      ||.||.
T Consensus         2 CP~Cg~    7 (47)
T PF04606_consen    2 CPHCGS    7 (47)
T ss_pred             cCCCCC
Confidence            555554


No 263
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.49  E-value=34  Score=18.97  Aligned_cols=18  Identities=11%  Similarity=0.285  Sum_probs=7.7

Q ss_pred             ccCCCccc-ccCHHHHHHH
Q psy13443         15 ECDFCPYG-AKQAADVHNH   32 (188)
Q Consensus        15 ~C~~C~~~-f~~~~~l~~H   32 (188)
                      +|.+|.+. +.+...+..-
T Consensus         4 kCiiCd~v~~iD~rt~~tK   22 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTK   22 (68)
T ss_pred             eEEEecceeeecchhHHHH
Confidence            45555532 3344444433


No 264
>KOG1842|consensus
Probab=26.32  E-value=40  Score=26.92  Aligned_cols=28  Identities=18%  Similarity=0.446  Sum_probs=25.5

Q ss_pred             ccccCCCcccccCHHHHHHHHHhhhcCC
Q psy13443         13 QFECDFCPYGAKQAADVHNHVQQIHMGV   40 (188)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~   40 (188)
                      .|-|++|...|.....|..|+...|++.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            5899999999999999999998888754


No 265
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=26.11  E-value=16  Score=28.12  Aligned_cols=37  Identities=30%  Similarity=0.606  Sum_probs=14.4

Q ss_pred             ccccCCCcccccCHHHHH---HHHHhhhcCCc--ccCCCCCC
Q psy13443         13 QFECDFCPYGAKQAADVH---NHVQQIHMGVN--FVCVHCKQ   49 (188)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~---~H~~~~~~~~~--~~C~~C~~   49 (188)
                      -+.|..|.++.......=   .|....+....  |+|..|+.
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~  293 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGN  293 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCC
Confidence            367888887655443332   33222222222  78888887


No 266
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=25.93  E-value=33  Score=21.21  Aligned_cols=12  Identities=17%  Similarity=0.492  Sum_probs=6.6

Q ss_pred             eecccCccccCC
Q psy13443        107 FRCALCAYSARR  118 (188)
Q Consensus       107 ~~C~~C~~~~~~  118 (188)
                      ..|+.||..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            456666655444


No 267
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=25.53  E-value=48  Score=17.55  Aligned_cols=10  Identities=30%  Similarity=1.109  Sum_probs=5.0

Q ss_pred             ceecccCccc
Q psy13443        106 PFRCALCAYS  115 (188)
Q Consensus       106 ~~~C~~C~~~  115 (188)
                      .+.|..||..
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            3555555543


No 268
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.49  E-value=49  Score=25.14  Aligned_cols=11  Identities=18%  Similarity=0.265  Sum_probs=6.3

Q ss_pred             eecCCCCCCCC
Q psy13443         79 YMCYLCNYHTP   89 (188)
Q Consensus        79 ~~C~~C~~~f~   89 (188)
                      ..|+.|+..+.
T Consensus        44 ~~CP~C~~~lr   54 (309)
T TIGR00570        44 GSCPECDTPLR   54 (309)
T ss_pred             CCCCCCCCccc
Confidence            35666665544


No 269
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=25.42  E-value=49  Score=16.77  Aligned_cols=7  Identities=29%  Similarity=0.928  Sum_probs=3.3

Q ss_pred             eecCCCC
Q psy13443         79 YMCYLCN   85 (188)
Q Consensus        79 ~~C~~C~   85 (188)
                      +.|..|+
T Consensus        29 ~~C~~C~   35 (50)
T cd00029          29 LRCSWCK   35 (50)
T ss_pred             eEcCCCC
Confidence            4444443


No 270
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=25.23  E-value=43  Score=21.88  Aligned_cols=8  Identities=25%  Similarity=0.642  Sum_probs=4.5

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      ..|+.||.
T Consensus        29 ~hCp~Cg~   36 (131)
T COG1645          29 KHCPKCGT   36 (131)
T ss_pred             hhCcccCC
Confidence            45666655


No 271
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=25.17  E-value=88  Score=19.76  Aligned_cols=22  Identities=9%  Similarity=0.169  Sum_probs=14.8

Q ss_pred             ceeecCCCCCCCCCHHHHHHHH
Q psy13443         77 YTYMCYLCNYHTPTRKYMRTHI   98 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~~~l~~H~   98 (188)
                      ..+.|+.||..+.+......-.
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~~   51 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRNS   51 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHHH
Confidence            4467888888887776544443


No 272
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=24.65  E-value=51  Score=16.66  Aligned_cols=7  Identities=29%  Similarity=0.880  Sum_probs=3.3

Q ss_pred             cCCCCCC
Q psy13443         43 VCVHCKQ   49 (188)
Q Consensus        43 ~C~~C~~   49 (188)
                      .|+.|+.
T Consensus        19 ~Cp~C~~   25 (41)
T PF06677_consen   19 HCPDCGT   25 (41)
T ss_pred             ccCCCCC
Confidence            4555543


No 273
>PRK05580 primosome assembly protein PriA; Validated
Probab=24.63  E-value=55  Score=27.96  Aligned_cols=21  Identities=19%  Similarity=0.410  Sum_probs=11.2

Q ss_pred             ccccccccccCCCCceeecCCCCCC
Q psy13443         63 HCATCVDMVRPDASYTYMCYLCNYH   87 (188)
Q Consensus        63 ~c~~c~~~~~~~~~~~~~C~~C~~~   87 (188)
                      .|..|+...    ..+..|+.|+..
T Consensus       410 ~Ch~Cg~~~----~~~~~Cp~Cg~~  430 (679)
T PRK05580        410 RCHHCGYQE----PIPKACPECGST  430 (679)
T ss_pred             ECCCCcCCC----CCCCCCCCCcCC
Confidence            455555443    234567777643


No 274
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=24.61  E-value=51  Score=21.58  Aligned_cols=10  Identities=20%  Similarity=0.710  Sum_probs=5.9

Q ss_pred             ceecccCccc
Q psy13443        106 PFRCALCAYS  115 (188)
Q Consensus       106 ~~~C~~C~~~  115 (188)
                      ...||.|+..
T Consensus       105 ~~~CPwCg~~  114 (131)
T PF15616_consen  105 EVTCPWCGNE  114 (131)
T ss_pred             CEECCCCCCe
Confidence            4566666654


No 275
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=24.25  E-value=62  Score=15.95  Aligned_cols=21  Identities=19%  Similarity=0.638  Sum_probs=8.6

Q ss_pred             ccccCCCccccc-CHHHH-HHHH
Q psy13443         13 QFECDFCPYGAK-QAADV-HNHV   33 (188)
Q Consensus        13 ~~~C~~C~~~f~-~~~~l-~~H~   33 (188)
                      .|-|+.|...|. +.... ..|.
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT
T ss_pred             CeecccccceecCCChHHHHHhh
Confidence            478999998883 44333 4453


No 276
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.17  E-value=30  Score=20.47  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=2.8

Q ss_pred             ccCCCCCC
Q psy13443         42 FVCVHCKQ   49 (188)
Q Consensus        42 ~~C~~C~~   49 (188)
                      |.|+.|+-
T Consensus        23 F~CPfC~~   30 (81)
T PF05129_consen   23 FDCPFCNH   30 (81)
T ss_dssp             ---TTT--
T ss_pred             EcCCcCCC
Confidence            89999983


No 277
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=24.16  E-value=38  Score=18.52  Aligned_cols=9  Identities=22%  Similarity=0.538  Sum_probs=4.8

Q ss_pred             CccCCCCcc
Q psy13443        134 PHACGMCGY  142 (188)
Q Consensus       134 ~~~C~~C~~  142 (188)
                      +|.|..|..
T Consensus        31 tYmC~eC~~   39 (56)
T PF09963_consen   31 TYMCDECKE   39 (56)
T ss_pred             ceeChhHHH
Confidence            355555543


No 278
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.07  E-value=39  Score=18.11  Aligned_cols=11  Identities=27%  Similarity=0.640  Sum_probs=7.4

Q ss_pred             ccCCCCccccc
Q psy13443        135 HACGMCGYECA  145 (188)
Q Consensus       135 ~~C~~C~~~f~  145 (188)
                      +.|++||..+.
T Consensus         1 i~CPyCge~~~   11 (52)
T PF14255_consen    1 IQCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCCeeE
Confidence            35788887654


No 279
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=23.84  E-value=27  Score=18.64  Aligned_cols=7  Identities=43%  Similarity=1.236  Sum_probs=2.8

Q ss_pred             cCCCCCC
Q psy13443         43 VCVHCKQ   49 (188)
Q Consensus        43 ~C~~C~~   49 (188)
                      .|..|++
T Consensus         6 RC~~Cnk   12 (51)
T PF10122_consen    6 RCGHCNK   12 (51)
T ss_pred             eccchhH
Confidence            3444433


No 280
>KOG1940|consensus
Probab=23.81  E-value=1.4e+02  Score=22.47  Aligned_cols=19  Identities=11%  Similarity=0.510  Sum_probs=11.0

Q ss_pred             cccCCCcccccCHHHHHHHH
Q psy13443         14 FECDFCPYGAKQAADVHNHV   33 (188)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~H~   33 (188)
                      |.|++|.+ ..+...+.++.
T Consensus       197 y~CP~C~~-~~d~~~~~~~~  215 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRKL  215 (276)
T ss_pred             CCCCcccc-hHHHHHHHHHH
Confidence            66777666 55555544444


No 281
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=22.96  E-value=37  Score=16.07  Aligned_cols=11  Identities=18%  Similarity=0.703  Sum_probs=7.1

Q ss_pred             ccccCCCcccc
Q psy13443         13 QFECDFCPYGA   23 (188)
Q Consensus        13 ~~~C~~C~~~f   23 (188)
                      .|+|..|+..+
T Consensus         7 ~ykC~~Cgniv   17 (34)
T TIGR00319         7 VYKCEVCGNIV   17 (34)
T ss_pred             EEEcCCCCcEE
Confidence            56777777654


No 283
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=22.93  E-value=38  Score=16.02  Aligned_cols=10  Identities=20%  Similarity=0.800  Sum_probs=5.3

Q ss_pred             ccccCCCccc
Q psy13443         13 QFECDFCPYG   22 (188)
Q Consensus        13 ~~~C~~C~~~   22 (188)
                      .|+|..|+..
T Consensus         4 ~ykC~~CGni   13 (34)
T cd00974           4 VYKCEICGNI   13 (34)
T ss_pred             EEEcCCCCcE
Confidence            3555555544


No 284
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.68  E-value=75  Score=21.46  Aligned_cols=15  Identities=20%  Similarity=0.286  Sum_probs=7.5

Q ss_pred             ceeecCCCCCCCCCH
Q psy13443         77 YTYMCYLCNYHTPTR   91 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~   91 (188)
                      .|.-|..||+.|++.
T Consensus        67 ~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   67 APSYCHNCGKPYPWT   81 (158)
T ss_pred             CChhHHhCCCCCchH
Confidence            344455555555544


No 286
>KOG0978|consensus
Probab=22.68  E-value=13  Score=31.49  Aligned_cols=13  Identities=15%  Similarity=0.416  Sum_probs=6.9

Q ss_pred             eecccCccccCCc
Q psy13443        107 FRCALCAYSARRK  119 (188)
Q Consensus       107 ~~C~~C~~~~~~~  119 (188)
                      -+||.|+.+|...
T Consensus       679 RKCP~Cn~aFgan  691 (698)
T KOG0978|consen  679 RKCPKCNAAFGAN  691 (698)
T ss_pred             CCCCCCCCCCCcc
Confidence            3555555555543


No 287
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=22.60  E-value=76  Score=16.99  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=6.1

Q ss_pred             CCceecccCcc
Q psy13443        104 EKPFRCALCAY  114 (188)
Q Consensus       104 ~~~~~C~~C~~  114 (188)
                      .....|+.||+
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            34456666654


No 288
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=22.49  E-value=27  Score=16.88  Aligned_cols=8  Identities=38%  Similarity=1.157  Sum_probs=3.8

Q ss_pred             ecCCCCCC
Q psy13443         80 MCYLCNYH   87 (188)
Q Consensus        80 ~C~~C~~~   87 (188)
                      .|..|++.
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            45555544


No 289
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.46  E-value=81  Score=15.60  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=4.3

Q ss_pred             ceeecCCCCC
Q psy13443         77 YTYMCYLCNY   86 (188)
Q Consensus        77 ~~~~C~~C~~   86 (188)
                      +.+.|.+|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            3455555554


No 290
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.26  E-value=63  Score=20.49  Aligned_cols=15  Identities=13%  Similarity=0.211  Sum_probs=8.1

Q ss_pred             eecccCccccCCchh
Q psy13443        107 FRCALCAYSARRKTH  121 (188)
Q Consensus       107 ~~C~~C~~~~~~~~~  121 (188)
                      ..|..|+.......+
T Consensus        86 D~CM~C~~pLTLd~~  100 (114)
T PF11023_consen   86 DACMHCKEPLTLDPS  100 (114)
T ss_pred             hccCcCCCcCccCch
Confidence            466666655544443


No 291
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=21.99  E-value=1.8e+02  Score=17.10  Aligned_cols=6  Identities=33%  Similarity=0.944  Sum_probs=1.9

Q ss_pred             ecCCCC
Q psy13443         80 MCYLCN   85 (188)
Q Consensus        80 ~C~~C~   85 (188)
                      .|..|+
T Consensus        30 AC~eC~   35 (80)
T PF14569_consen   30 ACHECA   35 (80)
T ss_dssp             S-SSS-
T ss_pred             EEcccC
Confidence            355553


No 292
>PHA02942 putative transposase; Provisional
Probab=21.94  E-value=74  Score=25.05  Aligned_cols=14  Identities=36%  Similarity=0.975  Sum_probs=9.2

Q ss_pred             CceecccCccccCC
Q psy13443        105 KPFRCALCAYSARR  118 (188)
Q Consensus       105 ~~~~C~~C~~~~~~  118 (188)
                      +.|.|+.||.....
T Consensus       341 r~f~C~~CG~~~dr  354 (383)
T PHA02942        341 RYFHCPSCGYENDR  354 (383)
T ss_pred             CEEECCCCCCEeCc
Confidence            46777777766544


No 293
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=21.09  E-value=38  Score=21.09  Aligned_cols=23  Identities=26%  Similarity=0.423  Sum_probs=17.9

Q ss_pred             CccCCCCcccccCcHHHHHHHHH
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRK  156 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~  156 (188)
                      .+-|-.|.+.|.+...|..|.+.
T Consensus        55 qhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhcc
Confidence            35677888888888888888753


No 294
>PTZ00448 hypothetical protein; Provisional
Probab=21.02  E-value=74  Score=24.83  Aligned_cols=24  Identities=17%  Similarity=0.449  Sum_probs=18.6

Q ss_pred             eeecCCCCCCCCCHHHHHHHHHhc
Q psy13443         78 TYMCYLCNYHTPTRKYMRTHIDTH  101 (188)
Q Consensus        78 ~~~C~~C~~~f~~~~~l~~H~~~h  101 (188)
                      .|.|..|+-.|.+......|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            477888888888778888887653


No 295
>KOG0782|consensus
Probab=20.84  E-value=12  Score=30.75  Aligned_cols=51  Identities=14%  Similarity=0.204  Sum_probs=34.0

Q ss_pred             HHHHHHHhcCCCCceecccCccccCCchhHHHHHHhhcCCCCccCCCCcccccCcH
Q psy13443         93 YMRTHIDTHNGEKPFRCALCAYSARRKTHLDDHMRRHTGEKPHACGMCGYECAQGS  148 (188)
Q Consensus        93 ~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  148 (188)
                      .|..|-=+|....-=+|..|++.|..+..+..-.     --...|.+|..+|..+.
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~FhsKE-----ivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFFHSKE-----IVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheeecccc-----EEEEEehHHHHHhhcch
Confidence            5667766666555568999999998876552211     12367899988887654


No 296
>KOG2906|consensus
Probab=20.83  E-value=51  Score=20.28  Aligned_cols=15  Identities=27%  Similarity=0.700  Sum_probs=11.0

Q ss_pred             ceeecCCCCCCCCCH
Q psy13443         77 YTYMCYLCNYHTPTR   91 (188)
Q Consensus        77 ~~~~C~~C~~~f~~~   91 (188)
                      ..|.|..|++.|+-.
T Consensus        20 ~rf~C~tCpY~~~I~   34 (105)
T KOG2906|consen   20 NRFSCRTCPYVFPIS   34 (105)
T ss_pred             eeEEcCCCCceeeEe
Confidence            357889998877644


No 297
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=20.71  E-value=81  Score=27.50  Aligned_cols=9  Identities=22%  Similarity=0.453  Sum_probs=4.5

Q ss_pred             cCCCccccc
Q psy13443         16 CDFCPYGAK   24 (188)
Q Consensus        16 C~~C~~~f~   24 (188)
                      |..|++.|.
T Consensus       463 C~~C~kkFf  471 (1374)
T PTZ00303        463 CPSCGRAFI  471 (1374)
T ss_pred             ccCcCCccc
Confidence            555555543


No 298
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=20.54  E-value=1.9e+02  Score=22.02  Aligned_cols=13  Identities=15%  Similarity=0.187  Sum_probs=8.9

Q ss_pred             ceeecCCCCCCCC
Q psy13443         77 YTYMCYLCNYHTP   89 (188)
Q Consensus        77 ~~~~C~~C~~~f~   89 (188)
                      ..|.|..|+..+.
T Consensus       285 ~f~~C~~Cg~~w~  297 (299)
T TIGR01385       285 TFVTCEECGNRWK  297 (299)
T ss_pred             EEEEcCCCCCeee
Confidence            3478888886543


No 299
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.33  E-value=73  Score=21.75  Aligned_cols=13  Identities=23%  Similarity=0.652  Sum_probs=7.3

Q ss_pred             eecccCccccCCc
Q psy13443        107 FRCALCAYSARRK  119 (188)
Q Consensus       107 ~~C~~C~~~~~~~  119 (188)
                      +.|+.||+.|=--
T Consensus       131 ~~C~~CgkiYW~G  143 (165)
T COG1656         131 YRCPKCGKIYWKG  143 (165)
T ss_pred             eECCCCcccccCc
Confidence            5566666665333


No 300
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=20.22  E-value=70  Score=25.77  Aligned_cols=30  Identities=23%  Similarity=0.306  Sum_probs=23.7

Q ss_pred             CCccCCCCcccccCcHHHHHHHHHhcCCCC
Q psy13443        133 KPHACGMCGYECAQGSQLMQHLRKVHKVDK  162 (188)
Q Consensus       133 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  162 (188)
                      .-|.|..|-+.|.+...|.+|+.......|
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~~C~~~~P  226 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMKKCDLKHP  226 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHhcCCCCCC
Confidence            348999999999999999999875543333


No 301
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.17  E-value=80  Score=25.85  Aligned_cols=29  Identities=21%  Similarity=0.325  Sum_probs=23.5

Q ss_pred             CccCCCCcccccCcHHHHHHHHHhcCCCC
Q psy13443        134 PHACGMCGYECAQGSQLMQHLRKVHKVDK  162 (188)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  162 (188)
                      -|.|..|-+.|.+...|.+|+....-..|
T Consensus       280 LYICEfCLkY~~s~~~l~rH~~~C~~rhP  308 (552)
T PTZ00064        280 LHFCEYCLDFFCFEDELIRHLSRCQLRHP  308 (552)
T ss_pred             EEEccchhhhhCCHHHHHHHHhcCCCCCC
Confidence            48999999999999999999875543333


Done!