BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy13460
(281 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4DJ3|A Chain A, Unwinding The Differences Of The Mammalian Period Clock
Proteins From Crystal Structure To Cellular Function
pdb|4DJ3|B Chain B, Unwinding The Differences Of The Mammalian Period Clock
Proteins From Crystal Structure To Cellular Function
Length = 317
Score = 28.5 bits (62), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 8/33 (24%)
Query: 95 FWNCWNGESSRYQCSPGLAY--------DREAR 119
FWN W +S+Y+C+P + DRE R
Sbjct: 95 FWNNWTQRASQYECAPAKPFFCRICGGGDREKR 127
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.138 0.457
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,104,462
Number of Sequences: 62578
Number of extensions: 455880
Number of successful extensions: 682
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 678
Number of HSP's gapped (non-prelim): 4
length of query: 281
length of database: 14,973,337
effective HSP length: 98
effective length of query: 183
effective length of database: 8,840,693
effective search space: 1617846819
effective search space used: 1617846819
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)