BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13474
         (105 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V4J|B Chain B, The Crystal Structure Of Desulfovibrio Vulgaris
           Dissimilatory Sulfite Reductase Bound To Dsrc Provides
           Novel Insights Into The Mechanism Of Sulfate Respiration
 pdb|2V4J|E Chain E, The Crystal Structure Of Desulfovibrio Vulgaris
           Dissimilatory Sulfite Reductase Bound To Dsrc Provides
           Novel Insights Into The Mechanism Of Sulfate Respiration
          Length = 381

 Score = 26.9 bits (58), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 40  MDDAAECFENMLLRIHYHIASEEAEDMCGAKHC 72
           MD+  E F++M L     I+     +MCGA HC
Sbjct: 166 MDEVFEDFQSMRLPAPVRISLACCINMCGAVHC 198


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.133    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,353,836
Number of Sequences: 62578
Number of extensions: 64183
Number of successful extensions: 88
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 87
Number of HSP's gapped (non-prelim): 1
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)