Query         psy13474
Match_columns 105
No_of_seqs    68 out of 70
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:19:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13474.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13474hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd02661 Peptidase_C19E A subfa  99.1 2.2E-10 4.8E-15   86.8   6.2   93    2-97     51-147 (304)
  2 PF00443 UCH:  Ubiquitin carbox  98.6   4E-08 8.8E-13   71.2   3.6   91    1-94     55-151 (269)
  3 cd02657 Peptidase_C19A A subfa  98.6 1.7E-07 3.7E-12   72.1   6.8   94    1-101    49-147 (305)
  4 cd02660 Peptidase_C19D A subfa  98.6 1.2E-07 2.7E-12   73.4   5.9   94    1-97     51-146 (328)
  5 cd02663 Peptidase_C19G A subfa  98.4 3.1E-07 6.8E-12   71.3   5.3   93    1-96     27-131 (300)
  6 cd02668 Peptidase_C19L A subfa  98.4 5.2E-07 1.1E-11   70.7   5.1   84    1-96     57-140 (324)
  7 cd02659 peptidase_C19C A subfa  98.2 1.8E-06 3.9E-11   67.1   3.6   88    1-98     50-137 (334)
  8 cd02658 Peptidase_C19B A subfa  97.9 1.6E-05 3.5E-10   61.4   4.9   71   13-94     76-146 (311)
  9 KOG1887|consensus               97.9 3.1E-06 6.8E-11   75.3   0.5   87   19-105   528-627 (806)
 10 cd02664 Peptidase_C19H A subfa  97.8   3E-05 6.6E-10   61.2   5.2   75    1-96     46-121 (327)
 11 cd02666 Peptidase_C19J A subfa  97.6 8.4E-05 1.8E-09   60.2   4.7   81    1-92     70-156 (343)
 12 cd02671 Peptidase_C19O A subfa  97.6 0.00013 2.7E-09   58.6   5.6   67   11-96     79-145 (332)
 13 cd02667 Peptidase_C19K A subfa  97.6 0.00011 2.3E-09   56.7   4.8   61   17-96     31-91  (279)
 14 cd02669 Peptidase_C19M A subfa  97.5 0.00029 6.2E-09   58.3   6.1   83    3-92    170-254 (440)
 15 cd02257 Peptidase_C19 Peptidas  97.4 0.00013 2.9E-09   51.6   2.5   57   39-95     21-78  (255)
 16 cd02673 Peptidase_C19Q A subfa  96.9 0.00081 1.8E-08   52.0   3.4   76   21-96     14-92  (245)
 17 cd02674 Peptidase_C19R A subfa  96.6  0.0018 3.9E-08   47.4   2.8   43   39-97     21-63  (230)
 18 cd02662 Peptidase_C19F A subfa  94.3   0.066 1.4E-06   40.5   3.9   42   39-96     33-74  (240)
 19 KOG1865|consensus               92.8    0.25 5.5E-06   43.1   5.4   84   11-97    167-251 (545)
 20 PF13423 UCH_1:  Ubiquitin carb  88.8    0.88 1.9E-05   35.2   4.7   91    3-96     47-144 (295)
 21 KOG2026|consensus               87.7     1.1 2.5E-05   38.1   5.0   59   13-79    194-252 (442)
 22 PF13405 EF-hand_6:  EF-hand do  85.6    0.49 1.1E-05   25.1   1.2   27    1-27      2-28  (31)
 23 smart00054 EFh EF-hand, calciu  81.5     1.8 3.8E-05   20.2   2.2   27    1-27      2-28  (29)
 24 PF08715 Viral_protease:  Papai  80.8    0.77 1.7E-05   37.6   1.1   29   32-60    155-183 (320)
 25 KOG1867|consensus               80.2     3.3 7.1E-05   35.6   4.7   91    2-95    212-307 (492)
 26 cd00051 EFh EF-hand, calcium b  78.4     7.4 0.00016   21.2   4.5   28    1-28      2-29  (63)
 27 PF13499 EF-hand_7:  EF-hand do  77.6     2.5 5.4E-05   25.2   2.4   30    1-30      2-31  (66)
 28 PF00036 EF-hand_1:  EF hand;    77.5     1.4 3.1E-05   23.5   1.2   28    1-28      2-29  (29)
 29 KOG0037|consensus               71.4     4.1 8.8E-05   32.0   2.7   27    2-28    127-153 (221)
 30 cd02665 Peptidase_C19I A subfa  70.9     4.1   9E-05   31.4   2.7   61   39-101    21-83  (228)
 31 cd00052 EH Eps15 homology doma  59.8      13 0.00028   21.6   2.9   26    2-27      2-27  (67)
 32 PF00515 TPR_1:  Tetratricopept  59.5     5.3 0.00011   20.7   1.0   21   33-53     10-30  (34)
 33 cd05027 S-100B S-100B: S-100B   59.1      20 0.00043   23.5   3.9   49    1-54     10-60  (88)
 34 PF13174 TPR_6:  Tetratricopept  58.6     4.4 9.5E-05   20.4   0.5   19   35-53     11-29  (33)
 35 KOG4849|consensus               57.4      15 0.00032   31.5   3.7   43   11-60    367-409 (498)
 36 COG3109 ProQ Activator of osmo  57.2      11 0.00024   29.1   2.7   44    2-46     36-81  (208)
 37 PF13176 TPR_7:  Tetratricopept  56.8     9.7 0.00021   20.5   1.8   23   33-56      8-30  (36)
 38 PF13428 TPR_14:  Tetratricopep  55.9      15 0.00032   20.4   2.5   27   22-53      4-30  (44)
 39 KOG0027|consensus               55.3      25 0.00054   24.5   4.2   33    1-33     87-119 (151)
 40 PF07719 TPR_2:  Tetratricopept  54.3     7.3 0.00016   19.8   1.0   21   32-52      9-29  (34)
 41 PF02748 PyrI_C:  Aspartate car  53.9     5.1 0.00011   24.5   0.4   28   66-93      8-43  (52)
 42 cd05022 S-100A13 S-100A13: S-1  52.8      33 0.00072   22.6   4.2   28    1-28     10-38  (89)
 43 PF13202 EF-hand_5:  EF hand; P  52.6     8.4 0.00018   19.7   1.0   23    1-23      1-23  (25)
 44 cd02064 FAD_synthetase_N FAD s  51.2       8 0.00017   28.2   1.1   27   12-48    142-168 (180)
 45 PF06667 PspB:  Phage shock pro  46.4      36 0.00078   22.4   3.5   37   11-53     31-67  (75)
 46 PF03130 HEAT_PBS:  PBS lyase H  44.4      45 0.00097   17.1   3.1   19   35-54      7-25  (27)
 47 KOG1872|consensus               44.4      28  0.0006   30.3   3.4   59    2-62    158-219 (473)
 48 PF14803 Nudix_N_2:  Nudix N-te  42.5       9  0.0002   21.5   0.2   13   81-93     18-30  (34)
 49 smart00027 EH Eps15 homology d  42.3      22 0.00048   23.0   2.1   27    1-27     12-38  (96)
 50 smart00764 Citrate_ly_lig Citr  41.9      13 0.00029   27.6   1.0   27   12-48    149-175 (182)
 51 COG3423 Nlp Predicted transcri  40.6      13 0.00029   25.0   0.8   24   11-34     28-51  (82)
 52 KOG1868|consensus               38.8      40 0.00086   30.3   3.6   83   11-96    365-475 (653)
 53 PRK15359 type III secretion sy  38.7      36 0.00078   23.6   2.8   42   12-53      7-53  (144)
 54 PRK10220 hypothetical protein;  38.5      15 0.00032   26.1   0.8   22   78-99     13-34  (111)
 55 cd02169 Citrate_lyase_ligase C  37.7      17 0.00037   29.2   1.1   27   11-47    263-289 (297)
 56 cd05026 S-100Z S-100Z: S-100Z   37.4      71  0.0015   20.8   3.9   28    1-28     12-41  (93)
 57 KOG1863|consensus               36.7      42  0.0009   31.6   3.6   83    1-95    219-301 (1093)
 58 cd00213 S-100 S-100: S-100 dom  36.3      46   0.001   20.9   2.8   28    1-28     10-39  (88)
 59 PRK07143 hypothetical protein;  35.8      21 0.00046   28.5   1.4   27   12-48    146-172 (279)
 60 PF13181 TPR_8:  Tetratricopept  35.0      24 0.00051   17.9   1.1   19   34-52     11-29  (34)
 61 COG4871 Uncharacterized protei  34.8      12 0.00027   28.6  -0.1   21   40-60     92-112 (193)
 62 PF08274 PhnA_Zn_Ribbon:  PhnA   34.4     8.7 0.00019   21.1  -0.7   13   83-95     17-29  (30)
 63 TIGR00686 phnA alkylphosphonat  34.2      17 0.00037   25.7   0.5   22   78-99     12-33  (109)
 64 PF01535 PPR:  PPR repeat;  Int  33.2      22 0.00048   17.3   0.8   18   35-52     11-28  (31)
 65 PRK00893 aspartate carbamoyltr  32.9      18 0.00038   26.9   0.5   29   66-94    107-143 (152)
 66 PRK05627 bifunctional riboflav  32.8      32 0.00069   27.7   1.9   28   11-48    156-183 (305)
 67 PF13041 PPR_2:  PPR repeat fam  31.7      27 0.00058   19.7   1.0   19   35-53     14-32  (50)
 68 PF12854 PPR_1:  PPR repeat      31.6      20 0.00044   19.2   0.5   14   36-49     19-32  (34)
 69 PRK10292 hypothetical protein;  31.6      21 0.00045   23.4   0.6   32   17-48     37-68  (69)
 70 cd05029 S-100A6 S-100A6: S-100  31.5 1.3E+02  0.0028   19.5   4.4   25    3-27     14-40  (88)
 71 TIGR00083 ribF riboflavin kina  30.2      31 0.00068   27.6   1.5   26   14-49    142-167 (288)
 72 cd05025 S-100A1 S-100A1: S-100  29.7      46   0.001   21.3   2.0   27    1-27     11-39  (92)
 73 PF12688 TPR_5:  Tetratrico pep  29.5      67  0.0015   22.3   2.9   37   14-52     30-66  (120)
 74 PF13432 TPR_16:  Tetratricopep  28.1      35 0.00076   19.7   1.1   21   33-53     40-60  (65)
 75 KOG0027|consensus               27.9 1.4E+02  0.0031   20.6   4.4   31    1-31     10-40  (151)
 76 PRK13376 pyrB bifunctional asp  27.7      22 0.00048   31.0   0.3   30   66-95    480-517 (525)
 77 PF09279 EF-hand_like:  Phospho  27.6      95  0.0021   19.3   3.2   27    1-28      2-28  (83)
 78 PF12387 Peptidase_C74:  Pestiv  27.4      30 0.00064   26.7   0.9   34   66-99    156-189 (200)
 79 cd05031 S-100A10_like S-100A10  27.4      58  0.0013   20.9   2.2   27    1-27     10-38  (94)
 80 PF09976 TPR_21:  Tetratricopep  27.3      47   0.001   22.7   1.8   23   31-53     55-77  (145)
 81 PF01599 Ribosomal_S27:  Riboso  27.3      28 0.00061   21.0   0.6   29   65-94     19-47  (47)
 82 PF05741 zf-nanos:  Nanos RNA b  26.3      24 0.00053   22.0   0.2   14   83-96     31-44  (55)
 83 PTZ00183 centrin; Provisional   26.0      73  0.0016   21.3   2.6   28    1-28     19-46  (158)
 84 PF10825 DUF2752:  Protein of u  25.1      27 0.00059   21.0   0.3   17   72-94      2-18  (52)
 85 PF12994 DUF3878:  Domain of un  25.0      28 0.00061   28.6   0.4   11   39-49     32-42  (299)
 86 TIGR00756 PPR pentatricopeptid  24.8      47   0.001   16.2   1.1   18   35-52     11-28  (35)
 87 PF13371 TPR_9:  Tetratricopept  23.6      43 0.00093   19.6   0.9   21   33-53     38-58  (73)
 88 PF14169 YdjO:  Cold-inducible   23.5      49  0.0011   20.9   1.2   31   64-94     18-48  (59)
 89 PF09538 FYDLN_acid:  Protein o  23.4      51  0.0011   22.9   1.4   19   80-99     22-40  (108)
 90 PF13414 TPR_11:  TPR repeat; P  23.3      60  0.0013   18.8   1.5   23   31-53     10-32  (69)
 91 PF12895 Apc3:  Anaphase-promot  23.0      38 0.00082   20.8   0.6   19   31-49     65-83  (84)
 92 PRK11788 tetratricopeptide rep  22.6 1.1E+02  0.0024   23.5   3.3   20   34-53    292-311 (389)
 93 TIGR00240 ATCase_reg aspartate  21.8      36 0.00077   25.3   0.4   29   66-94    105-141 (150)
 94 PF13374 TPR_10:  Tetratricopep  21.6   1E+02  0.0022   15.7   2.1   25   34-58     12-36  (42)
 95 PF14559 TPR_19:  Tetratricopep  21.1      49  0.0011   19.1   0.9   19   35-53      2-20  (68)
 96 PF09723 Zn-ribbon_8:  Zinc rib  20.9      32  0.0007   19.6  -0.0    8   86-93     27-34  (42)
 97 PF03604 DNA_RNApol_7kD:  DNA d  20.9      47   0.001   18.4   0.6   11   86-96      1-11  (32)
 98 PF06957 COPI_C:  Coatomer (COP  20.4      65  0.0014   27.5   1.7   31   31-61    211-241 (422)
 99 smart00834 CxxC_CXXC_SSSS Puta  20.3      49  0.0011   17.9   0.7   13   83-95     24-36  (41)
100 COG5207 UBP14 Isopeptidase T [  20.2 1.4E+02  0.0031   27.0   3.7   74   15-99    372-445 (749)

No 1  
>cd02661 Peptidase_C19E A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.09  E-value=2.2e-10  Score=86.76  Aligned_cols=93  Identities=17%  Similarity=0.247  Sum_probs=77.3

Q ss_pred             HHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhh----hccCCCCchhhhh
Q psy13474          2 QELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAE----DMCGAKHCIPHEK   77 (105)
Q Consensus         2 ~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~----d~c~~~~Ci~H~~   77 (105)
                      +.+|.+...++.+.++|..++++|...   ...|+.|.+.||.|.|..+|+.||.+.......    .......++.+++
T Consensus        51 ~~~~~~~~~~~~~~~~p~~~~~~l~~~---~~~f~~~~qqDa~Efl~~ll~~l~~~~~~~~~~~~~~~~~~~~~~~i~~~  127 (304)
T cd02661          51 EAHVERALASSGPGSAPRIFSSNLKQI---SKHFRIGRQEDAHEFLRYLLDAMQKACLDRFKKLKAVDPSSQETTLVQQI  127 (304)
T ss_pred             HHHHHHHHhCCCCccChHHHHHHHHHH---HHhhcCcchhhHHHHHHHHHHHHHHHHhhhcccccccCccccCCChhhhc
Confidence            467777788889999999999999875   457999999999999999999999875442211    2344567899999


Q ss_pred             hcceehhhhccCCcCCCCCC
Q psy13474         78 FAMTLVEQSVCGACGATSEP   97 (105)
Q Consensus        78 F~m~l~Eq~vC~~Cg~~S~p   97 (105)
                      |+..+..+.+|.+|+..+..
T Consensus       128 F~g~~~~~~~C~~C~~~s~~  147 (304)
T cd02661         128 FGGYLRSQVKCLNCKHVSNT  147 (304)
T ss_pred             CCcEEeeeEEeCCCCCCcCc
Confidence            99999999999999998874


No 2  
>PF00443 UCH:  Ubiquitin carboxyl-terminal hydrolase;  InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C19 (ubiquitin-specific protease family, clan CA). Families within the CA clan are loosely termed papain-like as protein fold of the peptidase unit resembles that of papain, the type example for clan CA. Predicted active site residues for members of this family and family C1 occur in the same order in the sequence: N/Q, C, H. The type example is human ubiquitin-specific protease 14. Ubiquitin is highly conserved, commonly found conjugated to proteins in eukaryotic cells, where it may act as a marker for rapid degradation, or it may have a chaperone function in protein assembly []. The ubiquitin is released by cleavage from the bound protein by a protease []. A number of deubiquitinising proteases are known: all are activated by thiol compounds [, ], and inhibited by thiol-blocking agents and ubiquitin aldehyde [, ], and as such have the properties of cysteine proteases []. The deubiquitinsing proteases can be split into 2 size ranges (20-30 kDa, IPR001578 from INTERPRO, and 100-200 kDa) []: this family are the 100-200 kDa peptides which includes the Ubp1 ubiquitin peptidase from yeast. Only one conserved cysteine can be identified, along with two conserved histidines. The spacing between the cysteine and the second histidine is thought to be more representative of the cysteine/histidine spacing of a cysteine protease catalytic dyad [].; GO: 0004221 ubiquitin thiolesterase activity, 0006511 ubiquitin-dependent protein catabolic process; PDB: 2LBC_A 3MHH_A 3MHS_A 3M99_A 2Y6E_D 2VHF_A 2HD5_A 3NHE_A 2IBI_A 1NBF_B ....
Probab=98.59  E-value=4e-08  Score=71.19  Aligned_cols=91  Identities=22%  Similarity=0.319  Sum_probs=76.9

Q ss_pred             CHHHhhhhhhc--CCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh----hhccCCCCchh
Q psy13474          1 MQELFSQLQSS--HESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA----EDMCGAKHCIP   74 (105)
Q Consensus         1 l~~iF~~~~~s--~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~----~d~c~~~~Ci~   74 (105)
                      |+.||..+..+  ....+.|..+..+|...++.   |..|.+.||.|.|..||+.|+..+.....    ...-....++.
T Consensus        55 l~~l~~~~~~~~~~~~~i~~~~~~~~l~~~~~~---~~~~~qqDa~E~l~~ll~~l~~~~~~~~~~~~~~~~~~~~~~~~  131 (269)
T PF00443_consen   55 LQNLFRSLWSSNSSDSSISPSDFINALSSINPS---FSNGEQQDAHEFLSFLLDWLDEEFNSSFKRKSWKNTNSSEDSLI  131 (269)
T ss_dssp             HHHHHHHHHSSCSSSSEEHCHHHHHHHHHHCGG---GGSSSTEEHHHHHHHHHHHHHHHHTSCSSHHHHHHHHCCEESHH
T ss_pred             hhhhhhhhhhhcccccceeeccccccccccccc---cccccccchhhhhcccccccchhhcccccccccccccccccccc
Confidence            46788888877  88999999999999986444   99999999999999999999998877432    34556677899


Q ss_pred             hhhhcceehhhhccCCcCCC
Q psy13474         75 HEKFAMTLVEQSVCGACGAT   94 (105)
Q Consensus        75 H~~F~m~l~Eq~vC~~Cg~~   94 (105)
                      +.+|+..+.+...|..|+..
T Consensus       132 ~~~f~~~~~~~~~c~~c~~~  151 (269)
T PF00443_consen  132 SDLFGGQFESSIKCSSCKNS  151 (269)
T ss_dssp             HHHH-EEEEEEEEETTTTCE
T ss_pred             cccccccccccccccccccc
Confidence            99999999999999999875


No 3  
>cd02657 Peptidase_C19A A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.57  E-value=1.7e-07  Score=72.06  Aligned_cols=94  Identities=19%  Similarity=0.305  Sum_probs=72.4

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhh---cccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQRF---QLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEK   77 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~F---q~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~   77 (105)
                      |+.||.+++.+.+ ++.|..+..+|.+.++.=.-.   ..++-.||.|.|..+|+.||..+..      .....++.+.+
T Consensus        49 l~~L~~~l~~~~~-~i~p~~~~~~l~~~~~~f~~~~~~~~~~QqDA~EFl~~lld~L~~~~~~------~~~~~~~i~~~  121 (305)
T cd02657          49 LRDLFDTMDKKQE-PVPPIEFLQLLRMAFPQFAEKQNQGGYAQQDAEECWSQLLSVLSQKLPG------AGSKGSFIDQL  121 (305)
T ss_pred             HHHHHHHHHhCCC-cCCcHHHHHHHHHHCcCcccccCCCCccccCHHHHHHHHHHHHHHHhcc------cCCCCcHHHHh
Confidence            4678888887654 899999999999865432112   4458899999999999999998764      22457799999


Q ss_pred             hcceehhhhccCCcC-CCC-CCCCCc
Q psy13474         78 FAMTLVEQSVCGACG-ATS-EPLPFT  101 (105)
Q Consensus        78 F~m~l~Eq~vC~~Cg-~~S-~p~~~t  101 (105)
                      |+..+..+.+|..|+ .++ ...||.
T Consensus       122 F~g~~~~~~~C~~C~~~~~~~~e~f~  147 (305)
T cd02657         122 FGIELETKMKCTESPDEEEVSTESEY  147 (305)
T ss_pred             hceEEEEEEEcCCCCCCCccccccce
Confidence            999999999999999 333 344444


No 4  
>cd02660 Peptidase_C19D A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.57  E-value=1.2e-07  Score=73.39  Aligned_cols=94  Identities=24%  Similarity=0.359  Sum_probs=73.2

Q ss_pred             CHHHhhhhhh-cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhh-ccCCCCchhhhhh
Q psy13474          1 MQELFSQLQS-SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAED-MCGAKHCIPHEKF   78 (105)
Q Consensus         1 l~~iF~~~~~-s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d-~c~~~~Ci~H~~F   78 (105)
                      |..||..+.. .....++|..+.+++...   ...|..+.+.||.|.|..||++||.......... .=....+|.+++|
T Consensus        51 l~~l~~~l~~~~~~~~~~~~~~l~~~~~~---~~~f~~~~QqDa~Efl~~ll~~l~~~~~~~~~~~~~~~~~~~~i~~~F  127 (328)
T cd02660          51 MDEIFQEFYYSGDRSPYGPINLLYLSWKH---SRNLAGYSQQDAHEFFQFLLDQLHTHYGGDKNEANDESHCNCIIHQTF  127 (328)
T ss_pred             HHHHHHHHhcCCCCCCcCHHHHHHHHHhh---chhhcccccccHHHHHHHHHHHHHHHhhcccccccccccCCceeEEec
Confidence            4578998844 456788999998888764   3479999999999999999999998765432110 0012257899999


Q ss_pred             cceehhhhccCCcCCCCCC
Q psy13474         79 AMTLVEQSVCGACGATSEP   97 (105)
Q Consensus        79 ~m~l~Eq~vC~~Cg~~S~p   97 (105)
                      +..+.....|..|+..+..
T Consensus       128 ~g~~~~~~~C~~C~~~s~~  146 (328)
T cd02660         128 SGSLQSSVTCQRCGGVSTT  146 (328)
T ss_pred             ccEEEeeeEcCCCCCccce
Confidence            9999999999999988764


No 5  
>cd02663 Peptidase_C19G A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.45  E-value=3.1e-07  Score=71.26  Aligned_cols=93  Identities=19%  Similarity=0.332  Sum_probs=74.4

Q ss_pred             CHHHhhhhhhc--CCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh----------hhccC
Q psy13474          1 MQELFSQLQSS--HESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA----------EDMCG   68 (105)
Q Consensus         1 l~~iF~~~~~s--~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~----------~d~c~   68 (105)
                      |+.||.+++.+  ...+++|..+.+||...   ...|..+...||.|.|..+|+.||..+.....          .....
T Consensus        27 L~~lf~~l~~~~~~~~~isP~~f~~~l~~~---~~~f~~~~QqDA~EFl~~lLd~l~~~l~~~~~~~~~~~~~~~~~~~~  103 (300)
T cd02663          27 LKDLFESISEQKKRTGVISPKKFITRLKRE---NELFDNYMHQDAHEFLNFLLNEIAEILDAERKAEKANRKLNNNNNAE  103 (300)
T ss_pred             HHHHHHHHHhCCCCCeeECHHHHHHHHHhh---cCCCCCCccccHHHHHHHHHHHHHHHHHHHhhcccccccccccccCC
Confidence            57889988775  45689999999999864   34799999999999999999999998753211          11223


Q ss_pred             CCCchhhhhhcceehhhhccCCcCCCCC
Q psy13474         69 AKHCIPHEKFAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        69 ~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      ....+.+.+|+-.+.....|.+|+..|.
T Consensus       104 ~~~~~i~~~F~G~~~~~~~C~~C~~~s~  131 (300)
T cd02663         104 PQPTWVHEIFQGILTNETRCLTCETVSS  131 (300)
T ss_pred             cCCCChhhhCceEEEeeEEeCCCCCCcc
Confidence            3467789999999999999999998764


No 6  
>cd02668 Peptidase_C19L A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.38  E-value=5.2e-07  Score=70.74  Aligned_cols=84  Identities=24%  Similarity=0.359  Sum_probs=69.9

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcc
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAM   80 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m   80 (105)
                      |+.||.+.+.++..+++|..|.++|.        |..|...||.|.|..||+.||..+.....    .....+.+..|+.
T Consensus        57 L~~lf~~l~~~~~~~i~p~~f~~~l~--------~~~~~QqDa~EFl~~lLd~L~~~l~~~~~----~~~~~~i~~~F~G  124 (324)
T cd02668          57 LQLIFAQLQFGNRSVVDPSGFVKALG--------LDTGQQQDAQEFSKLFLSLLEAKLSKSKN----PDLKNIVQDLFRG  124 (324)
T ss_pred             HHHHHHHHHhCCCceEChHHHHHHhC--------CCCccccCHHHHHHHHHHHHHHHHhhccC----Ccccchhhhhcce
Confidence            46789999989999999999999984        66788999999999999999987653211    1124688999999


Q ss_pred             eehhhhccCCcCCCCC
Q psy13474         81 TLVEQSVCGACGATSE   96 (105)
Q Consensus        81 ~l~Eq~vC~~Cg~~S~   96 (105)
                      .+..+..|..||.++.
T Consensus       125 ~~~~~~~C~~C~~~s~  140 (324)
T cd02668         125 EYSYVTQCSKCGRESS  140 (324)
T ss_pred             EEEEEEEeCCCCCccc
Confidence            9999999999998753


No 7  
>cd02659 peptidase_C19C A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.16  E-value=1.8e-06  Score=67.07  Aligned_cols=88  Identities=19%  Similarity=0.260  Sum_probs=69.5

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcc
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAM   80 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m   80 (105)
                      |+.||..++.++...++|+.++  +...+ ....|..|...||.|.|..||+.||......       ....+...+|+.
T Consensus        50 l~~lf~~~~~~~~~~~~~~~~~--~~~~~-~~~~~~~~~QqDa~Efl~~ll~~l~~~~~~~-------~~~~~i~~lF~g  119 (334)
T cd02659          50 LQRLFLFLQLSESPVKTTELTD--KTRSF-GWDSLNTFEQHDVQEFFRVLFDKLEEKLKGT-------GQEGLIKNLFGG  119 (334)
T ss_pred             HHHHHHHHHhCCccccCcchhh--eeccC-CCCCCCcccchhHHHHHHHHHHHHHHHhccC-------cccchhhhhCce
Confidence            4678888888888888887776  22222 2356899999999999999999999877542       234688899999


Q ss_pred             eehhhhccCCcCCCCCCC
Q psy13474         81 TLVEQSVCGACGATSEPL   98 (105)
Q Consensus        81 ~l~Eq~vC~~Cg~~S~p~   98 (105)
                      .+.....|..|+..|...
T Consensus       120 ~~~~~~~C~~C~~~s~~~  137 (334)
T cd02659         120 KLVNYIICKECPHESERE  137 (334)
T ss_pred             EEEeEEEecCCCceeccc
Confidence            999999999998776543


No 8  
>cd02658 Peptidase_C19B A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.92  E-value=1.6e-05  Score=61.38  Aligned_cols=71  Identities=13%  Similarity=0.279  Sum_probs=58.1

Q ss_pred             CCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCCcC
Q psy13474         13 ESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACG   92 (105)
Q Consensus        13 ~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg   92 (105)
                      ..++.|..++.+|...   ...|..|.+.||.|.|..+|+.||.......        .-.+.++|+..+.....|.+|+
T Consensus        76 ~~~i~p~~~~~~l~~~---~~~f~~~~QqDa~Efl~~ll~~l~~~~~~~~--------~~~~~~~f~~~~~~~i~C~~C~  144 (311)
T cd02658          76 QVGIKPSMFKALIGKG---HPEFSTMRQQDALEFLLHLIDKLDRESFKNL--------GLNPNDLFKFMIEDRLECLSCK  144 (311)
T ss_pred             ccccCcHHHHHHHhcc---ChhhcccccccHHHHHHHHHHHHHHhhcccc--------cCCchhheEEEeeEEEEcCCCC
Confidence            4579999999999864   4569999999999999999999998764211        1135689999999999999999


Q ss_pred             CC
Q psy13474         93 AT   94 (105)
Q Consensus        93 ~~   94 (105)
                      ..
T Consensus       145 ~~  146 (311)
T cd02658         145 KV  146 (311)
T ss_pred             CE
Confidence            63


No 9  
>KOG1887|consensus
Probab=97.89  E-value=3.1e-06  Score=75.33  Aligned_cols=87  Identities=13%  Similarity=0.089  Sum_probs=76.8

Q ss_pred             HHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh-------------hhccCCCCchhhhhhcceehhh
Q psy13474         19 DALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA-------------EDMCGAKHCIPHEKFAMTLVEQ   85 (105)
Q Consensus        19 ~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~-------------~d~c~~~~Ci~H~~F~m~l~Eq   85 (105)
                      ..++.||...|++.-.++...|++|++.|-++|.+|+...+..+.             .|.+...-||+|.+|||...|+
T Consensus       528 ~~vp~al~~~~~~s~~~~~~~~~~~S~lL~~ll~~l~~~~~~ss~~~~v~~aile~~~~Wk~~er~~l~~~lf~l~~~e~  607 (806)
T KOG1887|consen  528 LQVPIALQNFFPASVSESIKHEGVYSELLSDLLLSLEEVHNASSSAADVVVAILEFWQCWKNPERESLVNRLFTLEEKER  607 (806)
T ss_pred             ccCcchhhhcCCcchHHHHHhhhhHHHHHHHHHhhhHHHhhhcchhhHHHHHHHhcccccccHHHHHHHHhhhhhhhhhh
Confidence            478899999999999999999999999999999999987765422             2566677899999999999999


Q ss_pred             hccCCcCCCCCCCCCccCCC
Q psy13474         86 SVCGACGATSEPLPFTQEGK  105 (105)
Q Consensus        86 ~vC~~Cg~~S~p~~~t~~~~  105 (105)
                      +.|.+|+..+....+|++|.
T Consensus       608 ~Sc~~cr~~~n~peqsS~~~  627 (806)
T KOG1887|consen  608 MSCSKCRRDLNYPEQSSYGI  627 (806)
T ss_pred             ccccccccCCCCcchhhhhh
Confidence            99999999999888888763


No 10 
>cd02664 Peptidase_C19H A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.83  E-value=3e-05  Score=61.18  Aligned_cols=75  Identities=25%  Similarity=0.355  Sum_probs=60.5

Q ss_pred             CHHHhhhhhhcCCCCCChHH-HHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhc
Q psy13474          1 MQELFSQLQSSHESALPPDA-LRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFA   79 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~-LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~   79 (105)
                      |+.+|..+..++..+++|.. +-.++     ....|..|...||.|.|..+|+.||                .+..++|+
T Consensus        46 L~~lf~~l~~~~~~~~~~~~~~l~~~-----~~~~f~~~~QqDa~EFl~~lLd~l~----------------~~i~~~F~  104 (327)
T cd02664          46 LQLLQAHLMHTQRRAEAPPDYFLEAS-----RPPWFTPGSQQDCSEYLRYLLDRLH----------------TLIEKMFG  104 (327)
T ss_pred             HHHHHHHHhhcCCcccCCHHHHHHHh-----cccccCCCCcCCHHHHHHHHHHHHH----------------HHHHhhCc
Confidence            46788888888777777765 22222     2356999999999999999999999                37889999


Q ss_pred             ceehhhhccCCcCCCCC
Q psy13474         80 MTLVEQSVCGACGATSE   96 (105)
Q Consensus        80 m~l~Eq~vC~~Cg~~S~   96 (105)
                      ..+..+..|..|+..|.
T Consensus       105 G~~~~~i~C~~C~~~s~  121 (327)
T cd02664         105 GKLSTTIRCLNCNSTSA  121 (327)
T ss_pred             EEeEeEEEcCCCCCEec
Confidence            99999999999997765


No 11 
>cd02666 Peptidase_C19J A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.61  E-value=8.4e-05  Score=60.25  Aligned_cols=81  Identities=20%  Similarity=0.278  Sum_probs=64.5

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhh------hccCCCCchh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAE------DMCGAKHCIP   74 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~------d~c~~~~Ci~   74 (105)
                      |+.||...+.+....+.|...=..|+.           .-.||.|++..+|+.||..+......      +.=....++.
T Consensus        70 L~~LF~~l~~s~~~~v~P~~~l~~l~~-----------~QQDa~Ef~~~lld~Le~~lk~~~~~~~~~~~~~~~~~~~~I  138 (343)
T cd02666          70 LRSLFNDLIHSNTRSVTPSKELAYLAL-----------RQQDVTECIDNVLFQLEVALEPISNAFAGPDTEDDKEQSDLI  138 (343)
T ss_pred             HHHHHHHHHhCCCCccCcHHHHHhccc-----------cccchHHHHHHHHHHHHHHhcCccccccCcccccccchhhhh
Confidence            578999999999899988876555552           67899999999999999998654321      1112447899


Q ss_pred             hhhhcceehhhhccCCcC
Q psy13474         75 HEKFAMTLVEQSVCGACG   92 (105)
Q Consensus        75 H~~F~m~l~Eq~vC~~Cg   92 (105)
                      +++|+-.+-...+|..|+
T Consensus       139 ~~lF~G~~~~~i~c~~~~  156 (343)
T cd02666         139 KRLFSGKTKQQLVPESMG  156 (343)
T ss_pred             hHhceeeEEEEEEecccC
Confidence            999999988888898886


No 12 
>cd02671 Peptidase_C19O A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.60  E-value=0.00013  Score=58.58  Aligned_cols=67  Identities=24%  Similarity=0.324  Sum_probs=57.8

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCC
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGA   90 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~   90 (105)
                      +...+.+|..|..++.+.   ...|..+.-.||.|.|..+|+.||                .+.+..|+-.+..+..|.+
T Consensus        79 ~~~~~~~P~~~~~~l~~~---~~~f~~~~QQDA~EFl~~LLd~L~----------------~~i~~~F~g~~~~~~~C~~  139 (332)
T cd02671          79 DELANQAPRRLLNALREV---NPMYEGYLQHDAQEVLQCILGNIQ----------------ELVEKDFQGQLVLRTRCLE  139 (332)
T ss_pred             hcccccCHHHHHHHHHHh---ccccCCccccCHHHHHHHHHHHHH----------------HHHHhhhceEEEEEEEeCC
Confidence            344566799999999864   356889999999999999999998                2678899999999999999


Q ss_pred             cCCCCC
Q psy13474         91 CGATSE   96 (105)
Q Consensus        91 Cg~~S~   96 (105)
                      ||..|.
T Consensus       140 C~~~s~  145 (332)
T cd02671         140 CETFTE  145 (332)
T ss_pred             CCCeec
Confidence            998876


No 13 
>cd02667 Peptidase_C19K A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.59  E-value=0.00011  Score=56.71  Aligned_cols=61  Identities=20%  Similarity=0.317  Sum_probs=54.3

Q ss_pred             ChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCCcCCCCC
Q psy13474         17 PPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        17 ~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      .|..|..+|.+   ....|..|.+.||.|-|..+|+.||                .+.+.+|+..+.....|.+|+..|.
T Consensus        31 ~P~~~~~~l~~---~~~~f~~~~QqDA~Efl~~lld~l~----------------~~i~~~F~G~~~~~i~C~~C~~~s~   91 (279)
T cd02667          31 TPKELFSQVCR---KAPQFKGYQQQDSHELLRYLLDGLR----------------TFIDSIFGGELTSTIMCESCGTVSL   91 (279)
T ss_pred             CHHHHHHHHHH---hhHhhcCCchhhHHHHHHHHHHHHH----------------HhhhhhcceEEEEEEEcCCCCCEeC
Confidence            78888888875   4567999999999999999999999                3778899999999999999998876


No 14 
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.46  E-value=0.00029  Score=58.33  Aligned_cols=83  Identities=16%  Similarity=0.257  Sum_probs=62.8

Q ss_pred             HHhhhhhhcC--CCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcc
Q psy13474          3 ELFSQLQSSH--ESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAM   80 (105)
Q Consensus         3 ~iF~~~~~s~--~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m   80 (105)
                      .+|..+...+  ..+++|..+-++|...  ..+.|..+.-.||.|.|.-+|+.||..+....     ....||.|+.|+-
T Consensus       170 ~l~~kl~~~~~~~~~isP~~fl~~l~~~--~~~~f~~~~QqDA~EFl~~LLd~L~~~l~~~~-----~~~~~ii~~~F~G  242 (440)
T cd02669         170 ELIRKIWNPRNFKGHVSPHELLQAVSKV--SKKKFSITEQSDPVEFLSWLLNTLHKDLGGSK-----KPNSSIIHDCFQG  242 (440)
T ss_pred             HHHHHHhccccCCCccCHHHHHHHHHhh--cccccCCcccCCHHHHHHHHHHHHHHHhccCC-----CCCCCcceeccCc
Confidence            4455443222  5789999999999865  45779999999999999999999999876431     2347899999998


Q ss_pred             eehhhhccCCcC
Q psy13474         81 TLVEQSVCGACG   92 (105)
Q Consensus        81 ~l~Eq~vC~~Cg   92 (105)
                      .+.-...|..|.
T Consensus       243 ~l~~~~~c~~~~  254 (440)
T cd02669         243 KVQIETQKIKPH  254 (440)
T ss_pred             eEEEEEEeeccc
Confidence            876666665444


No 15 
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=97.36  E-value=0.00013  Score=51.57  Aligned_cols=57  Identities=23%  Similarity=0.321  Sum_probs=47.2

Q ss_pred             ccCcHHHHHHHHHHHhhhccCCchh-hhccCCCCchhhhhhcceehhhhccCCcCCCC
Q psy13474         39 FMDDAAECFENMLLRIHYHIASEEA-EDMCGAKHCIPHEKFAMTLVEQSVCGACGATS   95 (105)
Q Consensus        39 ~M~DA~E~fe~IL~~lH~~~~~~~~-~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S   95 (105)
                      .+.||.|+|..||+.||..+..... ...+.....+.+++|++.+.++.+|..|+..+
T Consensus        21 ~q~Da~E~l~~ll~~l~~~~~~~~~~~~~~~~~~~~i~~~F~~~~~~~~~c~~c~~~~   78 (255)
T cd02257          21 EQQDAHEFLLFLLDKLHEELKKSSKRTSDSSSLKSLIHDLFGGKLESTIVCLECGHES   78 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccccccccCCchhhhhcccEEeeEEECCCCCCCc
Confidence            8899999999999999998766332 23445556799999999999999999998543


No 16 
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=96.95  E-value=0.00081  Score=51.97  Aligned_cols=76  Identities=21%  Similarity=0.187  Sum_probs=57.6

Q ss_pred             HHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCch--hh-hccCCCCchhhhhhcceehhhhccCCcCCCCC
Q psy13474         21 LRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEE--AE-DMCGAKHCIPHEKFAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        21 LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~--~~-d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      --.||+..-.....|.-|...||-|-|--+|+.||.......  .. ..=...++.++..|+..+.....|.+||..|.
T Consensus        14 ~~~~~~~i~~~~~~F~~~~QQDAhEFL~~LLd~l~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~l~s~i~C~~C~~~s~   92 (245)
T cd02673          14 TMQALSSIGKINTEFDNDDQQDAHEFLLTLLEAIDDIMQVNRTNVPPSNIEIKRLNPLEAFKYTIESSYVCIGCSFEEN   92 (245)
T ss_pred             HHHHHHHHhhhhhhcCCCchhhHHHHHHHHHHHHHHHHHhhcccCCCCcccccccCHhHheeeEEEeEEEecCCCCeee
Confidence            346888887888999999999999999999999997432210  00 00012345678999999999999999998863


No 17 
>cd02674 Peptidase_C19R A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=96.58  E-value=0.0018  Score=47.41  Aligned_cols=43  Identities=30%  Similarity=0.367  Sum_probs=39.2

Q ss_pred             ccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCCcCCCCCC
Q psy13474         39 FMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGATSEP   97 (105)
Q Consensus        39 ~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~p   97 (105)
                      .+.||.|.|..||+.||                .+...+|+..+..+..|.+||..+..
T Consensus        21 ~QqDa~Ef~~~ll~~l~----------------~~i~~~F~~~~~~~~~C~~C~~~~~~   63 (230)
T cd02674          21 DQQDAQEFLLFLLDGLH----------------SIIVDLFQGQLKSRLTCLTCGKTSTT   63 (230)
T ss_pred             hhhhHHHHHHHHHHHHh----------------hhHHheeCCEEeCcEEcCCCcCCcce
Confidence            79999999999999999                26778999999999999999999863


No 18 
>cd02662 Peptidase_C19F A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=94.26  E-value=0.066  Score=40.50  Aligned_cols=42  Identities=29%  Similarity=0.414  Sum_probs=37.7

Q ss_pred             ccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCCcCCCCC
Q psy13474         39 FMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        39 ~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      ...||.|-|..+|+.||.                +....|...+.....|..||..|.
T Consensus        33 ~QqDa~EFl~~ll~~l~~----------------~i~~~F~g~~~~~i~C~~C~~~s~   74 (240)
T cd02662          33 EQQDAHELFQVLLETLEQ----------------LLKFPFDGLLASRIVCLQCGESSK   74 (240)
T ss_pred             hhcCHHHHHHHHHHHHHH----------------hccCccccEEEEEEEeCCCCCccC
Confidence            889999999999999991                466789999999999999999865


No 19 
>KOG1865|consensus
Probab=92.75  E-value=0.25  Score=43.12  Aligned_cols=84  Identities=18%  Similarity=0.215  Sum_probs=65.1

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh-hhccCCCCchhhhhhcceehhhhccC
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA-EDMCGAKHCIPHEKFAMTLVEQSVCG   89 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~-~d~c~~~~Ci~H~~F~m~l~Eq~vC~   89 (105)
                      +.+.+|.|..+..-|-.   =+..|.-|.=+||=|-|..+++.|+...-+... .+.=....=|+|++||=.|.-|.-|.
T Consensus       167 ~~g~pisP~~i~s~L~~---I~~~f~~grQEDAHEFLr~~vd~mqk~cL~g~~~~~~~sq~ttlv~~iFGG~LrS~vkC~  243 (545)
T KOG1865|consen  167 NPGHPISPSQILSNLRN---ISAHFGRGRQEDAHEFLRFTVDAMQKACLPGHKQVDPRSQDTTLVHQIFGGYLRSQIKCL  243 (545)
T ss_pred             CCCCccChHHHHHhhhh---hcccccCCchhhHHHHHHHHHHHHHHhhcCCCccCCcccccceehhhhhccchhhceecc
Confidence            34448999988777765   467799999999999999999999986532211 12222334599999999999999999


Q ss_pred             CcCCCCCC
Q psy13474         90 ACGATSEP   97 (105)
Q Consensus        90 ~Cg~~S~p   97 (105)
                      .|...|+-
T Consensus       244 ~C~~vS~t  251 (545)
T KOG1865|consen  244 HCKGVSDT  251 (545)
T ss_pred             cCCCcccc
Confidence            99998873


No 20 
>PF13423 UCH_1:  Ubiquitin carboxyl-terminal hydrolase
Probab=88.85  E-value=0.88  Score=35.25  Aligned_cols=91  Identities=18%  Similarity=0.234  Sum_probs=69.0

Q ss_pred             HHhhhhh-hcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh------hhccCCCCchhh
Q psy13474          3 ELFSQLQ-SSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA------EDMCGAKHCIPH   75 (105)
Q Consensus         3 ~iF~~~~-~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~------~d~c~~~~Ci~H   75 (105)
                      =||..+. .+++....+..+=+||+...   +-..+|.-.|..+.+.-||++||.-+.....      ........=...
T Consensus        47 fLf~ml~~~~~g~~cq~sNflr~l~~~~---~a~~l~~~~~iq~~~~Fll~~l~~~~~~~~~~~~~~~~~~~~~~~~~i~  123 (295)
T PF13423_consen   47 FLFDMLDSKAKGINCQASNFLRALSWIP---EAAALGLQQDIQSLNRFLLEQLSMELLTFKPDIFHTSENSSSSPESSIS  123 (295)
T ss_pred             HHHHHhhhhcCCCcChHHHHHHHHhcCH---HHHhcchhHHHHHHHHHHHHHHhHHHHhcCcccccccccccCCCcchHH
Confidence            3788888 78888888877777998763   4456788999999999999999997644331      112233334567


Q ss_pred             hhhcceehhhhccCCcCCCCC
Q psy13474         76 EKFAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        76 ~~F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      ++||+.......|.+||.++.
T Consensus       124 ~~f~~~~~~~~~c~~c~~~~~  144 (295)
T PF13423_consen  124 QLFGTSFETTIRCTSCGHESV  144 (295)
T ss_pred             HHhCcceeeeecccccCCeEE
Confidence            899999999999999999874


No 21 
>KOG2026|consensus
Probab=87.74  E-value=1.1  Score=38.08  Aligned_cols=59  Identities=20%  Similarity=0.424  Sum_probs=51.3

Q ss_pred             CCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhc
Q psy13474         13 ESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFA   79 (105)
Q Consensus        13 ~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~   79 (105)
                      ..-|+|-.+-.|.+.+  ..++|+.|+=.|+.|-+.-+|+.||..+.+..      ++..|.|--|.
T Consensus       194 k~hvSphe~lqaV~~~--s~k~f~i~~q~DpveFlswllntlhs~l~~~k------~~~SIi~~~fq  252 (442)
T KOG2026|consen  194 KGHVSPHEFLQAVMKL--SKKRFRIGQQSDPVEFLSWLLNTLHSDLRGSK------KASSIIHKSFQ  252 (442)
T ss_pred             cccCCHHHHHHHHHHH--hhhheecCCCCCHHHHHHHHHHHHHHHhCCCC------CchhHhhHhhc
Confidence            3568899999999987  88999999999999999999999999987754      56679998885


No 22 
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=85.57  E-value=0.49  Score=25.07  Aligned_cols=27  Identities=19%  Similarity=0.354  Sum_probs=23.9

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAE   27 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~   27 (105)
                      |+.+|..|+.....-|..+.|+.+|.+
T Consensus         2 l~~~F~~~D~d~dG~I~~~el~~~l~~   28 (31)
T PF13405_consen    2 LREAFKMFDKDGDGFIDFEELRAILRK   28 (31)
T ss_dssp             HHHHHHHH-TTSSSEEEHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCcCcHHHHHHHHHH
Confidence            478999999999999999999999984


No 23 
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=81.51  E-value=1.8  Score=20.24  Aligned_cols=27  Identities=11%  Similarity=0.304  Sum_probs=22.6

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAE   27 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~   27 (105)
                      ++.+|..++......|+.+.++..+..
T Consensus         2 ~~~~f~~~d~~~~g~i~~~e~~~~~~~   28 (29)
T smart00054        2 LKEAFRLFDKDGDGKIDFEEFKDLLKA   28 (29)
T ss_pred             HHHHHHHHCCCCCCcEeHHHHHHHHHh
Confidence            467899998888889999999988764


No 24 
>PF08715 Viral_protease:  Papain like viral protease;  InterPro: IPR014827 This family of viral proteases are similar to the papain protease and are required for proteolytic processing of the replicase polyprotein. The structure of this protein has shown it adopts a fold similar to that of de-ubiquitinating enzymes []. ; GO: 0004197 cysteine-type endopeptidase activity, 0008242 omega peptidase activity, 0016740 transferase activity; PDB: 3MP2_A 3EWP_B 3EWO_B 2FE8_A 3MJ5_B 3EKE_A 3EJF_A 3JZT_H 3ETI_E 3E9S_A.
Probab=80.80  E-value=0.77  Score=37.56  Aligned_cols=29  Identities=14%  Similarity=0.101  Sum_probs=17.8

Q ss_pred             hhhhcccccCcHHHHHHHHHHHhhhccCC
Q psy13474         32 QQRFQLGFMDDAAECFENMLLRIHYHIAS   60 (105)
Q Consensus        32 ~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~   60 (105)
                      ...+..|+|+||.++|+.+|+.++-..+.
T Consensus       155 ~~~~~~G~~gDa~~~L~~ll~~~~~~~~~  183 (320)
T PF08715_consen  155 STNAKKGDPGDAEYVLSKLLKDADLDYSV  183 (320)
T ss_dssp             HTT--TTS---HHHHHHHHHTTB-TTT-E
T ss_pred             HcCCCCCCCcCHHHHHHHHHHhccccceE
Confidence            34578999999999999999987765443


No 25 
>KOG1867|consensus
Probab=80.19  E-value=3.3  Score=35.65  Aligned_cols=91  Identities=25%  Similarity=0.319  Sum_probs=67.8

Q ss_pred             HHHhhhhhhcC-CCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCC----Cchhhh
Q psy13474          2 QELFSQLQSSH-ESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAK----HCIPHE   76 (105)
Q Consensus         2 ~~iF~~~~~s~-~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~----~Ci~H~   76 (105)
                      .++|....... ...+.|-.+....-+.-+   .|+-=.=-||-|-+..+++.+|.+...+.....|...    .||.|.
T Consensus       212 ~~~~~~~~s~~~~~~~sp~~~l~~~~k~~~---~~~g~~Qqda~eF~~~~~~~~~~~~~~~~k~~~~~~~~~~c~~iv~~  288 (492)
T KOG1867|consen  212 DRLFQALYSGHNRTPYSPFELLNLVWKHSP---NLAGYEQQDAHEFLIALLDRLHREKDDCGKSLIASQSNKQCPCIVHT  288 (492)
T ss_pred             hhhhhHhhcCCCCCCcChHHHHHHHHHhCc---ccccccccchHHHHHHhcccccccccccccccccccCCcccccccce
Confidence            45566665555 788888888777776433   3444555799999999999999999333333333332    699999


Q ss_pred             hhcceehhhhccCCcCCCC
Q psy13474         77 KFAMTLVEQSVCGACGATS   95 (105)
Q Consensus        77 ~F~m~l~Eq~vC~~Cg~~S   95 (105)
                      .|.=.+--+.+|..|+..|
T Consensus       289 ~F~G~L~~~v~c~~c~~~S  307 (492)
T KOG1867|consen  289 IFSGTLQSDVTCQTCGSKS  307 (492)
T ss_pred             eecceeccceeehhhccee
Confidence            9999999999999999988


No 26 
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=78.42  E-value=7.4  Score=21.16  Aligned_cols=28  Identities=21%  Similarity=0.442  Sum_probs=24.4

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~   28 (105)
                      ++.+|..|+......|+...++.+|...
T Consensus         2 ~~~~f~~~d~~~~g~l~~~e~~~~l~~~   29 (63)
T cd00051           2 LREAFRLFDKDGDGTISADELKAALKSL   29 (63)
T ss_pred             HHHHHHHhCCCCCCcCcHHHHHHHHHHh
Confidence            4678999988888899999999999875


No 27 
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=77.58  E-value=2.5  Score=25.16  Aligned_cols=30  Identities=23%  Similarity=0.377  Sum_probs=27.1

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhch
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFF   30 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~   30 (105)
                      |+.+|..|+......|....|+.++.....
T Consensus         2 l~~~F~~~D~d~~G~i~~~el~~~~~~~~~   31 (66)
T PF13499_consen    2 LKEAFKKFDKDGDGYISKEELRRALKHLGR   31 (66)
T ss_dssp             HHHHHHHHSTTSSSEEEHHHHHHHHHHTTS
T ss_pred             HHHHHHHHcCCccCCCCHHHHHHHHHHhcc
Confidence            578999999999999999999999998743


No 28 
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=77.54  E-value=1.4  Score=23.53  Aligned_cols=28  Identities=7%  Similarity=0.332  Sum_probs=24.9

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~   28 (105)
                      ++.+|..|+.....-|..+.++.++.++
T Consensus         2 ~~~~F~~~D~d~dG~I~~~Ef~~~~~~L   29 (29)
T PF00036_consen    2 LKEAFREFDKDGDGKIDFEEFKEMMKKL   29 (29)
T ss_dssp             HHHHHHHHSTTSSSEEEHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCCCCcCCHHHHHHHHHhC
Confidence            4789999999999999999999998753


No 29 
>KOG0037|consensus
Probab=71.36  E-value=4.1  Score=32.05  Aligned_cols=27  Identities=19%  Similarity=0.430  Sum_probs=25.1

Q ss_pred             HHHhhhhhhcCCCCCChHHHHHHHHhh
Q psy13474          2 QELFSQLQSSHESALPPDALRRALAEA   28 (105)
Q Consensus         2 ~~iF~~~~~s~~~~l~p~~LR~ALa~~   28 (105)
                      +.||.+|+..++..|.+..||.||...
T Consensus       127 r~vF~~~D~D~SG~I~~sEL~~Al~~~  153 (221)
T KOG0037|consen  127 RNVFRTYDRDRSGTIDSSELRQALTQL  153 (221)
T ss_pred             HHHHHhcccCCCCcccHHHHHHHHHHc
Confidence            679999999999999999999999875


No 30 
>cd02665 Peptidase_C19I A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=70.93  E-value=4.1  Score=31.45  Aligned_cols=61  Identities=13%  Similarity=0.020  Sum_probs=40.3

Q ss_pred             ccCcHHHHHHHHHHHhhhccCCchhh-hccCCCCchhhhhhcceehhhhccCCcCCCC-CCCCCc
Q psy13474         39 FMDDAAECFENMLLRIHYHIASEEAE-DMCGAKHCIPHEKFAMTLVEQSVCGACGATS-EPLPFT  101 (105)
Q Consensus        39 ~M~DA~E~fe~IL~~lH~~~~~~~~~-d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S-~p~~~t  101 (105)
                      ...||.|++-.||+.|+..+...... ..-.+..-+..++|+-.+...++|  ||..| +..+|.
T Consensus        21 ~QQDa~Ef~~~Lld~Le~~l~~~~~~~~~~~~~~~~i~~lF~G~~~~~~~~--~~~~s~~~E~F~   83 (228)
T cd02665          21 QQQDVSEFTHLLLDWLEDAFQAAAEAISPGEKSKNPMVQLFYGTFLTEGVL--EGKPFCNCETFG   83 (228)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccccccccccccchHhhceEEEEEEEEEE--CCCcccccCccE
Confidence            56899999999999999987542210 112234557889998777766777  44433 344443


No 31 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=59.84  E-value=13  Score=21.57  Aligned_cols=26  Identities=19%  Similarity=0.399  Sum_probs=23.6

Q ss_pred             HHHhhhhhhcCCCCCChHHHHHHHHh
Q psy13474          2 QELFSQLQSSHESALPPDALRRALAE   27 (105)
Q Consensus         2 ~~iF~~~~~s~~~~l~p~~LR~ALa~   27 (105)
                      +.+|..|+......|+.+.|+.+|..
T Consensus         2 ~~~F~~~D~~~~G~i~~~el~~~l~~   27 (67)
T cd00052           2 DQIFRSLDPDGDGLISGDEARPFLGK   27 (67)
T ss_pred             hHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            67899999999999999999999975


No 32 
>PF00515 TPR_1:  Tetratricopeptide repeat;  InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helix-turn-helix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices []. The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 degrees; within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; GO: 0005515 protein binding; PDB: 3SF4_C 2LNI_A 1ELW_A 2C0M_A 1FCH_B 3R9A_B 2J9Q_A 2C0L_A 1KT1_A 3FWV_A ....
Probab=59.47  E-value=5.3  Score=20.65  Aligned_cols=21  Identities=33%  Similarity=0.456  Sum_probs=16.9

Q ss_pred             hhhcccccCcHHHHHHHHHHH
Q psy13474         33 QRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        33 ~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      --++.|++++|.++|+..|+.
T Consensus        10 ~~~~~~~~~~A~~~~~~al~~   30 (34)
T PF00515_consen   10 AYFQLGDYEEALEYYQRALEL   30 (34)
T ss_dssp             HHHHTT-HHHHHHHHHHHHHH
T ss_pred             HHHHhCCchHHHHHHHHHHHH
Confidence            457899999999999998864


No 33 
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=59.05  E-value=20  Score=23.47  Aligned_cols=49  Identities=10%  Similarity=0.249  Sum_probs=32.1

Q ss_pred             CHHHhhhhh-hcCCC-CCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHh
Q psy13474          1 MQELFSQLQ-SSHES-ALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRI   54 (105)
Q Consensus         1 l~~iF~~~~-~s~~~-~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~l   54 (105)
                      |+++|..|+ ..... .|+.+.||..|...+|+-    +|...+..+ .+.++..+
T Consensus        10 l~~aF~~fD~~dgdG~~I~~~eL~~ll~~~~~~~----lg~~~~~~~-v~~~i~~~   60 (88)
T cd05027          10 LIDVFHQYSGREGDKHKLKKSELKELINNELSHF----LEEIKEQEV-VDKVMETL   60 (88)
T ss_pred             HHHHHHHhcccCCCcCEECHHHHHHHHHHHhHHH----hcCCCCHHH-HHHHHHHh
Confidence            468899997 45556 699999999999865533    555444333 34444433


No 34 
>PF13174 TPR_6:  Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A.
Probab=58.56  E-value=4.4  Score=20.42  Aligned_cols=19  Identities=37%  Similarity=0.733  Sum_probs=16.4

Q ss_pred             hcccccCcHHHHHHHHHHH
Q psy13474         35 FQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ++.|+.+.|.+.|+.+++.
T Consensus        11 ~~~g~~~~A~~~~~~~~~~   29 (33)
T PF13174_consen   11 YKLGDYDEAIEYFQRLIKR   29 (33)
T ss_dssp             HHHCHHHHHHHHHHHHHHH
T ss_pred             HHccCHHHHHHHHHHHHHH
Confidence            5679999999999999874


No 35 
>KOG4849|consensus
Probab=57.40  E-value=15  Score=31.46  Aligned_cols=43  Identities=21%  Similarity=0.268  Sum_probs=37.6

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCC
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIAS   60 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~   60 (105)
                      .++.+|++.++-+|.+..       ..|+..+|+|++.+.+..|.++-..
T Consensus       367 ~RNraiSSSAIsrAvsdA-------SaGDy~~AiETllTAI~lIKqSrv~  409 (498)
T KOG4849|consen  367 TRNRAISSSAISRAVSDA-------SAGDYKGAIETLLTAIQLIKQSRVG  409 (498)
T ss_pred             hhcchhhHHHHHHHhccc-------ccccchhHHHHHHHHHHHHHhhccc
Confidence            689999999999999864       5899999999999999998887544


No 36 
>COG3109 ProQ Activator of osmoprotectant transporter ProP [Signal transduction mechanisms]
Probab=57.17  E-value=11  Score=29.12  Aligned_cols=44  Identities=20%  Similarity=0.397  Sum_probs=36.5

Q ss_pred             HHHhhhhhh--cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHH
Q psy13474          2 QELFSQLQS--SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAEC   46 (105)
Q Consensus         2 ~~iF~~~~~--s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~   46 (105)
                      .+||.+++.  ...+-|+.+.||.||. +|-.+-|+-.|.-.+|..+
T Consensus        36 iGifQDl~e~lq~d~~vSktQLrqAlr-~yts~wRYl~g~k~gA~Rv   81 (208)
T COG3109          36 IGIFQDLAERLQDDENVSKTQLRQALR-LYTSSWRYLYGVKEGATRV   81 (208)
T ss_pred             hhHHHHHHHHHhccccccHHHHHHHHH-HHhcccceeeeccCCCcee
Confidence            378988876  5777799999999998 5788899999999888653


No 37 
>PF13176 TPR_7:  Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A.
Probab=56.84  E-value=9.7  Score=20.51  Aligned_cols=23  Identities=26%  Similarity=0.238  Sum_probs=17.1

Q ss_pred             hhhcccccCcHHHHHHHHHHHhhh
Q psy13474         33 QRFQLGFMDDAAECFENMLLRIHY   56 (105)
Q Consensus        33 ~~Fq~G~M~DA~E~fe~IL~~lH~   56 (105)
                      --++.|+.+.|.++|+..| .|+.
T Consensus         8 ~~~~~g~~~~Ai~~y~~aL-~l~~   30 (36)
T PF13176_consen    8 IYRQQGDYEKAIEYYEQAL-ALAR   30 (36)
T ss_dssp             HHHHCT-HHHHHHHHHHHH-HHHH
T ss_pred             HHHHcCCHHHHHHHHHHHH-Hhcc
Confidence            3467899999999999977 4443


No 38 
>PF13428 TPR_14:  Tetratricopeptide repeat
Probab=55.91  E-value=15  Score=20.45  Aligned_cols=27  Identities=33%  Similarity=0.348  Sum_probs=20.3

Q ss_pred             HHHHHhhchhhhhhcccccCcHHHHHHHHHHH
Q psy13474         22 RRALAEAFFDQQRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        22 R~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ...|+..|     .+.|+.++|.++|+.++..
T Consensus         4 ~~~la~~~-----~~~G~~~~A~~~~~~~l~~   30 (44)
T PF13428_consen    4 WLALARAY-----RRLGQPDEAERLLRRALAL   30 (44)
T ss_pred             HHHHHHHH-----HHcCCHHHHHHHHHHHHHH
Confidence            34455543     4579999999999999874


No 39 
>KOG0027|consensus
Probab=55.34  E-value=25  Score=24.53  Aligned_cols=33  Identities=12%  Similarity=0.222  Sum_probs=28.5

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQ   33 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~   33 (105)
                      |++.|.-|+.....-|++..||+.|.++.....
T Consensus        87 l~eaF~~fD~d~~G~Is~~el~~~l~~lg~~~~  119 (151)
T KOG0027|consen   87 LKEAFRVFDKDGDGFISASELKKVLTSLGEKLT  119 (151)
T ss_pred             HHHHHHHHccCCCCcCcHHHHHHHHHHhCCcCC
Confidence            468899999999999999999999999855544


No 40 
>PF07719 TPR_2:  Tetratricopeptide repeat;  InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. This repeat includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 from INTERPRO.; PDB: 1XNF_B 3Q15_A 4ABN_A 1OUV_A 3U4T_A 3MA5_C 2KCV_A 2KCL_A 2XEV_A 3NF1_A ....
Probab=54.31  E-value=7.3  Score=19.76  Aligned_cols=21  Identities=43%  Similarity=0.601  Sum_probs=16.6

Q ss_pred             hhhhcccccCcHHHHHHHHHH
Q psy13474         32 QQRFQLGFMDDAAECFENMLL   52 (105)
Q Consensus        32 ~~~Fq~G~M~DA~E~fe~IL~   52 (105)
                      .--|+.|+.++|.++|+..+.
T Consensus         9 ~~~~~~~~~~~A~~~~~~al~   29 (34)
T PF07719_consen    9 QAYYQLGNYEEAIEYFEKALE   29 (34)
T ss_dssp             HHHHHTT-HHHHHHHHHHHHH
T ss_pred             HHHHHhCCHHHHHHHHHHHHH
Confidence            345789999999999998875


No 41 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=53.94  E-value=5.1  Score=24.49  Aligned_cols=28  Identities=21%  Similarity=0.492  Sum_probs=16.6

Q ss_pred             ccCCCCchhh------hhhcceeh--hhhccCCcCC
Q psy13474         66 MCGAKHCIPH------EKFAMTLV--EQSVCGACGA   93 (105)
Q Consensus        66 ~c~~~~Ci~H------~~F~m~l~--Eq~vC~~Cg~   93 (105)
                      .|.+|.||+|      ++|...--  -...|..|+.
T Consensus         8 ~C~Np~CITn~~E~v~~~F~v~~~~~~~~rC~YCe~   43 (52)
T PF02748_consen    8 KCPNPNCITNSNEPVESRFYVIDKEPIKLRCHYCER   43 (52)
T ss_dssp             E-SSTTBTTT-TSSS--EEEEEETTTCEEEETTT--
T ss_pred             EcCCCCcccCCCCCCCceEEEEeCCCCEEEeeCCCC
Confidence            5999999999      56655111  3467888875


No 42 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=52.81  E-value=33  Score=22.65  Aligned_cols=28  Identities=11%  Similarity=0.240  Sum_probs=24.3

Q ss_pred             CHHHhhhhhh-cCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQS-SHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~-s~~~~l~p~~LR~ALa~~   28 (105)
                      |..+|..|+. .....|+.+.||..|.+.
T Consensus        10 l~~~F~~fd~~~~~g~i~~~ELk~ll~~e   38 (89)
T cd05022          10 LVSNFHKASVKGGKESLTASEFQELLTQQ   38 (89)
T ss_pred             HHHHHHHHhCCCCCCeECHHHHHHHHHHH
Confidence            4578999988 788899999999999984


No 43 
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=52.57  E-value=8.4  Score=19.72  Aligned_cols=23  Identities=13%  Similarity=0.468  Sum_probs=20.2

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHH
Q psy13474          1 MQELFSQLQSSHESALPPDALRR   23 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~   23 (105)
                      |+.+|.+++......|+...+++
T Consensus         1 l~~~F~~~D~d~DG~is~~E~~~   23 (25)
T PF13202_consen    1 LKDAFQQFDTDGDGKISFEEFQR   23 (25)
T ss_dssp             HHHHHHHHTTTSSSEEEHHHHHH
T ss_pred             CHHHHHHHcCCCCCcCCHHHHHH
Confidence            57889999999999999988876


No 44 
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme. FAD synthetase_N.  N-terminal domain of the bifunctional riboflavin biosynthesis protein riboflavin kinase/FAD synthetase. These enzymes have both ATP:riboflavin 5'-phosphotransferase and ATP:FMN-adenylyltransferase activities.  The N-terminal domain is believed to play a role in the adenylylation reaction of FAD synthetases. The C-terminal domain is thought to have kinase activity.  FAD synthetase is present among all kingdoms of life.  However, the bifunctional enzyme is not found in mammals, which use separate enzymes for FMN and FAD formation.
Probab=51.19  E-value=8  Score=28.18  Aligned_cols=27  Identities=26%  Similarity=0.284  Sum_probs=22.9

Q ss_pred             CCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHH
Q psy13474         12 HESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFE   48 (105)
Q Consensus        12 ~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe   48 (105)
                      .++.++++.+|++|+          .|+|++|.+.|.
T Consensus       142 ~~~~iSST~IR~~i~----------~G~i~~an~lLg  168 (180)
T cd02064         142 DGERVSSTRIREALA----------EGDVELANELLG  168 (180)
T ss_pred             CCcEEcHHHHHHHHH----------hCCHHHHHHHcC
Confidence            467899999999998          699999987653


No 45 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=46.38  E-value=36  Score=22.39  Aligned_cols=37  Identities=19%  Similarity=0.287  Sum_probs=27.2

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHH
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ..++.|+.+. ++-|.+++...     ..|.|-.|++|.||+.
T Consensus        31 ~~~~gLs~~d-~~~L~~L~~~a-----~rm~eRI~tLE~ILda   67 (75)
T PF06667_consen   31 KSSQGLSEED-EQRLQELYEQA-----ERMEERIETLERILDA   67 (75)
T ss_pred             ccCCCCCHHH-HHHHHHHHHHH-----HHHHHHHHHHHHHHcC
Confidence            3556677655 66677776554     4699999999999974


No 46 
>PF03130 HEAT_PBS:  PBS lyase HEAT-like repeat;  InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT. Cyanobacteria and red algae harvest light energy using macromolecular complexes known as phycobilisomes (PBS), peripherally attached to the photosynthetic membrane. The major components of PBS are the phycobiliproteins. These heterodimeric proteins are covalently attached to phycobilins: open-chain tetrapyrrole chromophores, which function as the photosynthetic light-harvesting pigments. Phycobiliproteins differ in sequence and in the nature and number of attached phycobilins to each of their subunits. These proteins include the lyase enzymes that specifically attach particular phycobilins to apophycobiliprotein subunits. The most comprehensively studied of these is the CpcE/Flyase P31967 from SWISSPROT, P31968 from SWISSPROT, which attaches phycocyanobilin (PCB) to the alpha subunit of apophycocyanin []. Similarly, MpeU/V attaches phycoerythrobilin to phycoerythrin II, while CpeY/Z is thought to be involved in phycoerythrobilin (PEB) attachment to phycoerythrin (PE) I (PEs I and II differ in sequence and in the number of attached molecules of PEB: PE I has five, PE II has six) []. All the reactions of the above lyases involve an apoprotein cysteine SH addition to a terminal delta 3,3'-double bond. Such a reaction is not possible in the case of phycoviolobilin (PVB), the phycobilin of alpha-phycoerythrocyanin (alpha-PEC). It is thought that in this case, PCB, not PVB, is first added to apo-alpha-PEC, and is then isomerized to PVB. The addition reaction has been shown to occur in the presence of either of the components of alpha-PEC-PVB lyase PecE or PecF (or both). The isomerisation reaction occurs only when both PecE and PecF components are present, i.e. the PecE/F phycobiliprotein lyase is also a phycobilin isomerase []. Another member of this family is the NblB protein, whose similarity to the phycobiliprotein lyases was previously noted []. This constitutively expressed protein is not known to have any lyase activity. It is thought to be involved in the coordination of PBS degradation with environmental nutrient limitation. It has been suggested that the similarity of NblB to the phycobiliprotein lyases is due to the ability to bind tetrapyrrole phycobilins via the common repeated motif [].; PDB: 1TE4_A.
Probab=44.40  E-value=45  Score=17.09  Aligned_cols=19  Identities=16%  Similarity=0.323  Sum_probs=10.8

Q ss_pred             hcccccCcHHHHHHHHHHHh
Q psy13474         35 FQLGFMDDAAECFENMLLRI   54 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~~l   54 (105)
                      +-+|+++| .++...+++.|
T Consensus         7 ~aLg~igd-~~ai~~L~~~L   25 (27)
T PF03130_consen    7 RALGQIGD-PRAIPALIEAL   25 (27)
T ss_dssp             HHHGGG-S-HHHHHHHHHHH
T ss_pred             HHHHHcCC-HHHHHHHHHHh
Confidence            34888888 45555555543


No 47 
>KOG1872|consensus
Probab=44.36  E-value=28  Score=30.27  Aligned_cols=59  Identities=20%  Similarity=0.305  Sum_probs=47.4

Q ss_pred             HHHhhhhhhcCCCCCChHHHHHHHHhhchhhhh-hccccc--CcHHHHHHHHHHHhhhccCCch
Q psy13474          2 QELFSQLQSSHESALPPDALRRALAEAFFDQQR-FQLGFM--DDAAECFENMLLRIHYHIASEE   62 (105)
Q Consensus         2 ~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~-Fq~G~M--~DA~E~fe~IL~~lH~~~~~~~   62 (105)
                      +.+|.+++.+  +.++|-.|-..|++.||.-.+ =+.|..  -||.||+-.++-.+|.......
T Consensus       158 R~~f~~~~~~--~~v~pi~llqtl~~~~Pqfa~~~~~g~~~qqda~ec~~~~m~~l~~~~~~~~  219 (473)
T KOG1872|consen  158 RTCFRPLCEK--GAVAPINLLQTLSSQYPQFAEWVEYGIYMQQDAAECWMEEPGMLTEALTVAT  219 (473)
T ss_pred             HHHHHhhhcc--CCcchHHHHHHHHHHhHHHHHHhhhhhHHHHHHhHhHHHhhhheeccccccc
Confidence            5678888877  999999999999999998744 234433  4899999999999999886643


No 48 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=42.51  E-value=9  Score=21.53  Aligned_cols=13  Identities=46%  Similarity=0.731  Sum_probs=8.9

Q ss_pred             eehhhhccCCcCC
Q psy13474         81 TLVEQSVCGACGA   93 (105)
Q Consensus        81 ~l~Eq~vC~~Cg~   93 (105)
                      .=.|+.||.+||.
T Consensus        18 d~r~R~vC~~Cg~   30 (34)
T PF14803_consen   18 DDRERLVCPACGF   30 (34)
T ss_dssp             -SS-EEEETTTTE
T ss_pred             CCccceECCCCCC
Confidence            3468899999984


No 49 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=42.25  E-value=22  Score=22.97  Aligned_cols=27  Identities=11%  Similarity=0.340  Sum_probs=23.9

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAE   27 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~   27 (105)
                      ++.+|..|+......|+...|+.+|..
T Consensus        12 l~~~F~~~D~d~~G~Is~~el~~~l~~   38 (96)
T smart00027       12 YEQIFRSLDKNQDGTVTGAQAKPILLK   38 (96)
T ss_pred             HHHHHHHhCCCCCCeEeHHHHHHHHHH
Confidence            467899999889999999999999976


No 50 
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain. Proteins of this family contain the C-terminal domain of citrate lyase ligase EC:6.2.1.22.
Probab=41.89  E-value=13  Score=27.61  Aligned_cols=27  Identities=15%  Similarity=0.329  Sum_probs=22.1

Q ss_pred             CCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHH
Q psy13474         12 HESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFE   48 (105)
Q Consensus        12 ~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe   48 (105)
                      .++.++++.+|++|+          .|.+++|.+.+=
T Consensus       149 ~g~~iSST~IR~~L~----------~G~v~~a~~lLP  175 (182)
T smart00764      149 NGQPISASTVRKLLK----------EGNLEELAKLVP  175 (182)
T ss_pred             CCcEECHHHHHHHHH----------cCCHHHHHHhCC
Confidence            577899999999997          578888887653


No 51 
>COG3423 Nlp Predicted transcriptional regulator [Transcription]
Probab=40.62  E-value=13  Score=25.01  Aligned_cols=24  Identities=29%  Similarity=0.419  Sum_probs=21.4

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhh
Q psy13474         11 SHESALPPDALRRALAEAFFDQQR   34 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~   34 (105)
                      |.+..|+|++|+++|..-|+...+
T Consensus        28 S~~agls~~tL~n~L~rp~pkgEr   51 (82)
T COG3423          28 SREAGLSSSTLANALDRPWPKGER   51 (82)
T ss_pred             HHHcCCCHHHHHHHHcCCCchHHH
Confidence            678889999999999999998755


No 52 
>KOG1868|consensus
Probab=38.80  E-value=40  Score=30.34  Aligned_cols=83  Identities=23%  Similarity=0.188  Sum_probs=56.1

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchh------------------------hhc
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEA------------------------EDM   66 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~------------------------~d~   66 (105)
                      .....+.|..+++.+.+.   ...|..+.--||.|.+.-.|+.||.++.....                        ...
T Consensus       365 ~~~~s~~P~~f~~~~~~y---~~~~~~~~Qqd~qEfl~~lld~Lhe~ln~~~~~~~~~p~~~~~~~~~~~~~~s~~s~~~  441 (653)
T KOG1868|consen  365 HGQFSVLPRRFIRVLKRY---SPNFSGYSQQDAQEFLIFLLDRLHEELNENTRPLKLSPLMGSYLLSELELSDSKKSLAE  441 (653)
T ss_pred             CCceecCcHHHHHHHhhc---ccccccccccchHHHHHHHHHhhhHhhhccCCCCccCccccccccccccccccchhHHH
Confidence            356668888999999875   33455555589999999999999999866421                        114


Q ss_pred             cCCCCchhhhh----hcceehhhhccCCcCCCCC
Q psy13474         67 CGAKHCIPHEK----FAMTLVEQSVCGACGATSE   96 (105)
Q Consensus        67 c~~~~Ci~H~~----F~m~l~Eq~vC~~Cg~~S~   96 (105)
                      +-...++.-.+    |..+.-....|..||.+|-
T Consensus       442 w~~~~~~~d~~i~~lf~gQ~ks~Lkc~~cg~~s~  475 (653)
T KOG1868|consen  442 WLRYLEEEDSKIGDLFVGQLKSYLKCQACGYTST  475 (653)
T ss_pred             HHhhccccchHHHHHHHHHHHhheehhhcCCcce
Confidence            44455533333    4444444456999999874


No 53 
>PRK15359 type III secretion system chaperone protein SscB; Provisional
Probab=38.69  E-value=36  Score=23.58  Aligned_cols=42  Identities=19%  Similarity=0.245  Sum_probs=30.5

Q ss_pred             CCCCCChHHHHHHHHhhc-----hhhhhhcccccCcHHHHHHHHHHH
Q psy13474         12 HESALPPDALRRALAEAF-----FDQQRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        12 ~~~~l~p~~LR~ALa~~~-----~~~~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      +..-+|.+.+++||+.-.     .....++.|..++|.+.|...+..
T Consensus         7 ~~~~~~~~~~~~al~~~p~~~~~~g~~~~~~g~~~~A~~~~~~al~~   53 (144)
T PRK15359          7 QKNKIPEDILKQLLSVDPETVYASGYASWQEGDYSRAVIDFSWLVMA   53 (144)
T ss_pred             cccCCHHHHHHHHHHcCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHc
Confidence            455677888888777521     134678899999999999887654


No 54 
>PRK10220 hypothetical protein; Provisional
Probab=38.45  E-value=15  Score=26.12  Aligned_cols=22  Identities=9%  Similarity=0.226  Sum_probs=16.2

Q ss_pred             hcceehhhhccCCcCCCCCCCC
Q psy13474         78 FAMTLVEQSVCGACGATSEPLP   99 (105)
Q Consensus        78 F~m~l~Eq~vC~~Cg~~S~p~~   99 (105)
                      |.-.--+..+|+.|++++.|-.
T Consensus        13 ytY~d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220         13 YTYEDNGMYICPECAHEWNDAE   34 (111)
T ss_pred             ceEcCCCeEECCcccCcCCccc
Confidence            3334445789999999998764


No 55 
>cd02169 Citrate_lyase_ligase Citrate lyase ligase. Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form. The acetylation of 1 molecule of deacetyl-citrate lyase to enzymatically active citrate lyase requires 6 molecules of ATP. The Adenylylyltranferase activity of the enzyme involves the formation of AMP and and pyrophosphate in the acetylation reaction.
Probab=37.71  E-value=17  Score=29.15  Aligned_cols=27  Identities=15%  Similarity=0.292  Sum_probs=23.0

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHH
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECF   47 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~f   47 (105)
                      ..++.++|+.+|++|.          .|+++.|.+.|
T Consensus       263 ~~g~~ISST~IR~~l~----------~G~v~~A~~lL  289 (297)
T cd02169         263 YDGQPISASTVRQLLK----------EGNLEEIAKLV  289 (297)
T ss_pred             cCCcEEcHHHHHHHHH----------cCCHHHHHHhC
Confidence            3677999999999999          68999988765


No 56 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=37.39  E-value=71  Score=20.77  Aligned_cols=28  Identities=14%  Similarity=0.323  Sum_probs=21.5

Q ss_pred             CHHHhhhhhhc-CCC-CCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQSS-HES-ALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~s-~~~-~l~p~~LR~ALa~~   28 (105)
                      ++++|..|+.. ... .|+...|+..|.+.
T Consensus        12 ~~~~F~~~dd~dgdg~~Is~~EL~~ll~~~   41 (93)
T cd05026          12 LIRIFHNYSGKEGDRYKLSKGELKELLQRE   41 (93)
T ss_pred             HHHHHHHHHccCCCCCEECHHHHHHHHHHH
Confidence            35679999954 333 59999999999764


No 57 
>KOG1863|consensus
Probab=36.72  E-value=42  Score=31.64  Aligned_cols=83  Identities=18%  Similarity=0.158  Sum_probs=60.4

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcc
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAM   80 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m   80 (105)
                      |+.+|.++|.++.+.|+++.|=+++-...     .-.+.=.|+.|-.-.+++.|=..+-.....       =..-.+|.-
T Consensus       219 lq~lF~~LQ~s~~k~Vdt~~~~~~~~~~~-----~~~~~QqDvqEf~~~l~d~LE~~~~~~~~~-------~~l~~lf~g  286 (1093)
T KOG1863|consen  219 LQRLFYELQMSKRKYVDTSELTKSLGWDS-----NDSFEQQDVQEFLTKLLDWLEDSMIDAKVE-------NTLQDLFTG  286 (1093)
T ss_pred             HHHHHHHHhhcCCCCcCchhhhhhhhccc-----ccHHhhhhHHHHHHHHHHHHHhhccchhhh-------hhhhhhhcC
Confidence            58899999999999999999999988652     334566899998888888876554332110       033446666


Q ss_pred             eehhhhccCCcCCCC
Q psy13474         81 TLVEQSVCGACGATS   95 (105)
Q Consensus        81 ~l~Eq~vC~~Cg~~S   95 (105)
                      .+.....|..|+-+|
T Consensus       287 ~~~~~i~c~~~~~~s  301 (1093)
T KOG1863|consen  287 KMKSVIKCIDVDFES  301 (1093)
T ss_pred             CcceEEEEEeeeeec
Confidence            677778888787777


No 58 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=36.33  E-value=46  Score=20.87  Aligned_cols=28  Identities=14%  Similarity=0.373  Sum_probs=23.8

Q ss_pred             CHHHhhhhhh--cCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQS--SHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~--s~~~~l~p~~LR~ALa~~   28 (105)
                      |+.+|..|+.  .....|+...|+.++...
T Consensus        10 l~~~F~~~D~~~~~~G~Is~~el~~~l~~~   39 (88)
T cd00213          10 IIDVFHKYSGKEGDKDTLSKKELKELLETE   39 (88)
T ss_pred             HHHHHHHHhhccCCCCcCcHHHHHHHHHHH
Confidence            4678999998  788899999999999753


No 59 
>PRK07143 hypothetical protein; Provisional
Probab=35.78  E-value=21  Score=28.47  Aligned_cols=27  Identities=7%  Similarity=0.182  Sum_probs=23.3

Q ss_pred             CCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHH
Q psy13474         12 HESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFE   48 (105)
Q Consensus        12 ~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe   48 (105)
                      .+..++|+.+|++|+          .|+|+.|.+.|.
T Consensus       146 ~g~~ISST~IR~~l~----------~G~i~~A~~lLG  172 (279)
T PRK07143        146 NQQKISTSLLKEFIE----------FGDIELLNSLLL  172 (279)
T ss_pred             CCcEEcHHHHHHHHH----------cCCHHHHHHHcC
Confidence            566899999999998          799999988764


No 60 
>PF13181 TPR_8:  Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A ....
Probab=35.04  E-value=24  Score=17.91  Aligned_cols=19  Identities=42%  Similarity=0.431  Sum_probs=15.7

Q ss_pred             hhcccccCcHHHHHHHHHH
Q psy13474         34 RFQLGFMDDAAECFENMLL   52 (105)
Q Consensus        34 ~Fq~G~M~DA~E~fe~IL~   52 (105)
                      -.++|+.+.|.++|+..++
T Consensus        11 y~~~~~~~~A~~~~~~a~~   29 (34)
T PF13181_consen   11 YEQLGDYEEALEYFEKALE   29 (34)
T ss_dssp             HHHTTSHHHHHHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHh
Confidence            3568999999999998775


No 61 
>COG4871 Uncharacterized protein conserved in archaea [Function unknown]
Probab=34.79  E-value=12  Score=28.61  Aligned_cols=21  Identities=29%  Similarity=0.310  Sum_probs=17.2

Q ss_pred             cCcHHHHHHHHHHHhhhccCC
Q psy13474         40 MDDAAECFENMLLRIHYHIAS   60 (105)
Q Consensus        40 M~DA~E~fe~IL~~lH~~~~~   60 (105)
                      -|+|.|.++.|.+.|...+..
T Consensus        92 edEAkeilgel~d~ineA~~k  112 (193)
T COG4871          92 EDEAKEILGELMDIINEAIAK  112 (193)
T ss_pred             HHHHHHHHHHHHHHHHHHHHc
Confidence            478999999999999886644


No 62 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=34.40  E-value=8.7  Score=21.14  Aligned_cols=13  Identities=38%  Similarity=0.611  Sum_probs=9.4

Q ss_pred             hhhhccCCcCCCC
Q psy13474         83 VEQSVCGACGATS   95 (105)
Q Consensus        83 ~Eq~vC~~Cg~~S   95 (105)
                      =+..||..||++.
T Consensus        17 ~~~~vCp~C~~ew   29 (30)
T PF08274_consen   17 GELLVCPECGHEW   29 (30)
T ss_dssp             SSSEEETTTTEEE
T ss_pred             CCEEeCCcccccC
Confidence            3567899998763


No 63 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=34.24  E-value=17  Score=25.72  Aligned_cols=22  Identities=14%  Similarity=0.167  Sum_probs=16.3

Q ss_pred             hcceehhhhccCCcCCCCCCCC
Q psy13474         78 FAMTLVEQSVCGACGATSEPLP   99 (105)
Q Consensus        78 F~m~l~Eq~vC~~Cg~~S~p~~   99 (105)
                      |.-.-=+..+|+.||+++.+--
T Consensus        12 ytY~dg~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686        12 YTYHDGTQLICPSCLYEWNENE   33 (109)
T ss_pred             ceEecCCeeECccccccccccc
Confidence            4444456789999999997753


No 64 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=33.17  E-value=22  Score=17.35  Aligned_cols=18  Identities=28%  Similarity=0.542  Sum_probs=14.3

Q ss_pred             hcccccCcHHHHHHHHHH
Q psy13474         35 FQLGFMDDAAECFENMLL   52 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~   52 (105)
                      -+.|+.++|.++|+.+.+
T Consensus        11 ~~~~~~~~a~~~~~~M~~   28 (31)
T PF01535_consen   11 CKMGQFEEALEVFDEMRE   28 (31)
T ss_pred             HccchHHHHHHHHHHHhH
Confidence            357899999999987754


No 65 
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=32.92  E-value=18  Score=26.91  Aligned_cols=29  Identities=24%  Similarity=0.559  Sum_probs=21.6

Q ss_pred             ccCCCCchhh------hhhcceehh--hhccCCcCCC
Q psy13474         66 MCGAKHCIPH------EKFAMTLVE--QSVCGACGAT   94 (105)
Q Consensus        66 ~c~~~~Ci~H------~~F~m~l~E--q~vC~~Cg~~   94 (105)
                      -|.+|.||+|      ++|-..=-+  ...|.+|+..
T Consensus       107 kC~Np~CITn~~E~v~~~F~v~~~~~~~~rC~YCe~~  143 (152)
T PRK00893        107 KCPNPNCITNTNEPVESRFYVVDKEPIKLRCKYCEKE  143 (152)
T ss_pred             ECCCCCCcCCCCcCcCcEEEEEeCCCCEEEeeCCCCE
Confidence            7999999999      456653233  5789999865


No 66 
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed
Probab=32.76  E-value=32  Score=27.66  Aligned_cols=28  Identities=25%  Similarity=0.311  Sum_probs=23.7

Q ss_pred             cCCCCCChHHHHHHHHhhchhhhhhcccccCcHHHHHH
Q psy13474         11 SHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFE   48 (105)
Q Consensus        11 s~~~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe   48 (105)
                      .+++.++|+.+|+.|.          .|+|++|.+.|.
T Consensus       156 ~~~~~ISST~IR~~I~----------~G~i~~A~~lLg  183 (305)
T PRK05627        156 EDGERVSSTAIRQALA----------EGDLELANKLLG  183 (305)
T ss_pred             cCCCcCchHHHHHHHH----------cCCHHHHHhhhc
Confidence            3567899999999998          799999988654


No 67 
>PF13041 PPR_2:  PPR repeat family 
Probab=31.67  E-value=27  Score=19.68  Aligned_cols=19  Identities=26%  Similarity=0.433  Sum_probs=15.9

Q ss_pred             hcccccCcHHHHHHHHHHH
Q psy13474         35 FQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ++.|++++|.++|+.+.+.
T Consensus        14 ~~~~~~~~a~~l~~~M~~~   32 (50)
T PF13041_consen   14 CKAGKFEEALKLFKEMKKR   32 (50)
T ss_pred             HHCcCHHHHHHHHHHHHHc
Confidence            5689999999999988754


No 68 
>PF12854 PPR_1:  PPR repeat
Probab=31.63  E-value=20  Score=19.23  Aligned_cols=14  Identities=36%  Similarity=0.608  Sum_probs=11.9

Q ss_pred             cccccCcHHHHHHH
Q psy13474         36 QLGFMDDAAECFEN   49 (105)
Q Consensus        36 q~G~M~DA~E~fe~   49 (105)
                      +.|.+++|.+.|+.
T Consensus        19 k~G~~~~A~~l~~~   32 (34)
T PF12854_consen   19 KAGRVDEAFELFDE   32 (34)
T ss_pred             HCCCHHHHHHHHHh
Confidence            47999999999874


No 69 
>PRK10292 hypothetical protein; Provisional
Probab=31.62  E-value=21  Score=23.36  Aligned_cols=32  Identities=19%  Similarity=0.237  Sum_probs=23.3

Q ss_pred             ChHHHHHHHHhhchhhhhhcccccCcHHHHHH
Q psy13474         17 PPDALRRALAEAFFDQQRFQLGFMDDAAECFE   48 (105)
Q Consensus        17 ~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe   48 (105)
                      =.+.||.||++---..+--+.-.|++|.+.|+
T Consensus        37 Ia~vlrTa~a~~r~~rs~~~~qaMe~~i~~L~   68 (69)
T PRK10292         37 IAGVLRTALANKRIQRSELEKQAMETVINALV   68 (69)
T ss_pred             HHHHHHHHHHhcccccCHHHHHHHHHHHHHhc
Confidence            35779999998755556667777888877664


No 70 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=31.49  E-value=1.3e+02  Score=19.53  Aligned_cols=25  Identities=12%  Similarity=0.364  Sum_probs=20.3

Q ss_pred             HHhhhhhh-cC-CCCCChHHHHHHHHh
Q psy13474          3 ELFSQLQS-SH-ESALPPDALRRALAE   27 (105)
Q Consensus         3 ~iF~~~~~-s~-~~~l~p~~LR~ALa~   27 (105)
                      .||.+|.. +. ...|+.+.||..|.+
T Consensus        14 ~~F~~y~~~~~~~g~Is~~EL~~~l~~   40 (88)
T cd05029          14 AIFHKYSGREGDKNTLSKKELKELIQK   40 (88)
T ss_pred             HHHHHHHccCCCCCEECHHHHHHHHHH
Confidence            57888886 33 569999999999975


No 71 
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase. multifunctional enzyme: riboflavin kinase (EC 2.7.1.26) (flavokinase) / FMN adenylyltransferase (EC 2.7.7.2) (FAD pyrophosphorylase) (FAD synthetase).
Probab=30.22  E-value=31  Score=27.55  Aligned_cols=26  Identities=23%  Similarity=0.296  Sum_probs=23.5

Q ss_pred             CCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHH
Q psy13474         14 SALPPDALRRALAEAFFDQQRFQLGFMDDAAECFEN   49 (105)
Q Consensus        14 ~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~   49 (105)
                      +.++|+.+|++|+          .|+++.|.+.|.-
T Consensus       142 ~~ISST~IR~~l~----------~G~i~~A~~lLGr  167 (288)
T TIGR00083       142 IRISSSAIRQALK----------NGDLELANKLLGR  167 (288)
T ss_pred             CeECHHHHHHHHH----------cCCHHHHHHhhhh
Confidence            7899999999999          7999999998764


No 72 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=29.72  E-value=46  Score=21.27  Aligned_cols=27  Identities=15%  Similarity=0.286  Sum_probs=22.2

Q ss_pred             CHHHhhhhh-hcCCC-CCChHHHHHHHHh
Q psy13474          1 MQELFSQLQ-SSHES-ALPPDALRRALAE   27 (105)
Q Consensus         1 l~~iF~~~~-~s~~~-~l~p~~LR~ALa~   27 (105)
                      |+++|..|+ ..... .|+...|+.+|..
T Consensus        11 l~~~F~~fDd~dg~G~~Is~~El~~~l~~   39 (92)
T cd05025          11 LINVFHAHSGKEGDKYKLSKKELKDLLQT   39 (92)
T ss_pred             HHHHHHHHhcccCCCCeECHHHHHHHHHH
Confidence            468899997 66666 5999999999964


No 73 
>PF12688 TPR_5:  Tetratrico peptide repeat
Probab=29.55  E-value=67  Score=22.28  Aligned_cols=37  Identities=30%  Similarity=0.304  Sum_probs=29.0

Q ss_pred             CCCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHH
Q psy13474         14 SALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLL   52 (105)
Q Consensus        14 ~~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~   52 (105)
                      ..++....++|+-.+  .+....+|+.++|...|+..+.
T Consensus        30 ~gL~~~~~~~a~i~l--astlr~LG~~deA~~~L~~~~~   66 (120)
T PF12688_consen   30 AGLSGADRRRALIQL--ASTLRNLGRYDEALALLEEALE   66 (120)
T ss_pred             cCCCchHHHHHHHHH--HHHHHHcCCHHHHHHHHHHHHH
Confidence            456666677777665  7777899999999999998765


No 74 
>PF13432 TPR_16:  Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B.
Probab=28.08  E-value=35  Score=19.74  Aligned_cols=21  Identities=29%  Similarity=0.330  Sum_probs=15.8

Q ss_pred             hhhcccccCcHHHHHHHHHHH
Q psy13474         33 QRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        33 ~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      -.++.|..++|.+.|+.+++.
T Consensus        40 ~~~~~g~~~~A~~~~~~a~~~   60 (65)
T PF13432_consen   40 ILYQQGRYDEALAYYERALEL   60 (65)
T ss_dssp             HHHHTT-HHHHHHHHHHHHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHH
Confidence            356789999999999988753


No 75 
>KOG0027|consensus
Probab=27.87  E-value=1.4e+02  Score=20.64  Aligned_cols=31  Identities=13%  Similarity=0.222  Sum_probs=26.4

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhhchh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEAFFD   31 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~~~~   31 (105)
                      |+++|..|+......++...|+.+|..+...
T Consensus        10 l~~~F~~fD~d~~G~i~~~el~~~lr~lg~~   40 (151)
T KOG0027|consen   10 LKEAFQLFDKDGDGKISVEELGAVLRSLGQN   40 (151)
T ss_pred             HHHHHHHHCCCCCCcccHHHHHHHHHHcCCC
Confidence            4688999999999999999999999886443


No 76 
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=27.74  E-value=22  Score=31.01  Aligned_cols=30  Identities=23%  Similarity=0.552  Sum_probs=23.5

Q ss_pred             ccCCCCchhhh--------hhcceehhhhccCCcCCCC
Q psy13474         66 MCGAKHCIPHE--------KFAMTLVEQSVCGACGATS   95 (105)
Q Consensus        66 ~c~~~~Ci~H~--------~F~m~l~Eq~vC~~Cg~~S   95 (105)
                      .|.+|.||+|.        +|-..--....|..|+..-
T Consensus       480 ~C~Np~CIt~~~~~e~~~~~F~~~~~~~~~C~YCe~~~  517 (525)
T PRK13376        480 RCKNENCITNPAHGENVSASFVRNEKGRFVCEYCETPH  517 (525)
T ss_pred             EeCCCCCcCCCCCCCcCCceEEEccCCEEEeeCCCCEe
Confidence            69999999998        4666544568999998753


No 77 
>PF09279 EF-hand_like:  Phosphoinositide-specific phospholipase C, efhand-like;  InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme []. ; PDB: 3OHM_B 3QR0_A 2ZKM_X 2FJU_B 3QR1_D 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B ....
Probab=27.56  E-value=95  Score=19.32  Aligned_cols=27  Identities=26%  Similarity=0.530  Sum_probs=23.2

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~   28 (105)
                      ++.||..|.. .++.|....+++=|.+.
T Consensus         2 i~~if~~ys~-~~~~mt~~~f~~FL~~e   28 (83)
T PF09279_consen    2 IEEIFRKYSS-DKEYMTAEEFRRFLREE   28 (83)
T ss_dssp             HHHHHHHHCT-TSSSEEHHHHHHHHHHT
T ss_pred             HHHHHHHHhC-CCCcCCHHHHHHHHHHH
Confidence            4689999955 79999999999999864


No 78 
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=27.44  E-value=30  Score=26.74  Aligned_cols=34  Identities=24%  Similarity=0.486  Sum_probs=22.2

Q ss_pred             ccCCCCchhhhhhcceehhhhccCCcCCCCCCCC
Q psy13474         66 MCGAKHCIPHEKFAMTLVEQSVCGACGATSEPLP   99 (105)
Q Consensus        66 ~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~S~p~~   99 (105)
                      .--++|||.-.+=--+=-..-.|++||..+.|..
T Consensus       156 Lsk~~hcilCtvCe~r~w~g~~CPKCGr~G~pi~  189 (200)
T PF12387_consen  156 LSKSKHCILCTVCEGREWKGGNCPKCGRHGKPIT  189 (200)
T ss_pred             ccCCCceEEEeeeecCccCCCCCCcccCCCCCee
Confidence            3346789874433333334467999999998864


No 79 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=27.43  E-value=58  Score=20.94  Aligned_cols=27  Identities=11%  Similarity=0.289  Sum_probs=22.1

Q ss_pred             CHHHhhhhhh-cC-CCCCChHHHHHHHHh
Q psy13474          1 MQELFSQLQS-SH-ESALPPDALRRALAE   27 (105)
Q Consensus         1 l~~iF~~~~~-s~-~~~l~p~~LR~ALa~   27 (105)
                      |.++|..|+. .. ...|+.+.|+.+|..
T Consensus        10 l~~~F~~~D~~dg~dG~Is~~El~~~l~~   38 (94)
T cd05031          10 LILTFHRYAGKDGDKNTLSRKELKKLMEK   38 (94)
T ss_pred             HHHHHHHHhccCCCCCeECHHHHHHHHHH
Confidence            4578889987 54 589999999999975


No 80 
>PF09976 TPR_21:  Tetratricopeptide repeat;  InterPro: IPR018704  This domain, found in various hypothetical prokaryotic proteins, has no known function. 
Probab=27.34  E-value=47  Score=22.70  Aligned_cols=23  Identities=22%  Similarity=0.381  Sum_probs=19.4

Q ss_pred             hhhhhcccccCcHHHHHHHHHHH
Q psy13474         31 DQQRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        31 ~~~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      .+..|..|+.+.|.+.|+.+++.
T Consensus        55 A~~~~~~g~~~~A~~~l~~~~~~   77 (145)
T PF09976_consen   55 AKAAYEQGDYDEAKAALEKALAN   77 (145)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHhh
Confidence            44567889999999999999984


No 81 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=27.34  E-value=28  Score=21.04  Aligned_cols=29  Identities=28%  Similarity=0.570  Sum_probs=19.4

Q ss_pred             hccCCCCchhhhhhcceehhhhccCCcCCC
Q psy13474         65 DMCGAKHCIPHEKFAMTLVEQSVCGACGAT   94 (105)
Q Consensus        65 d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~   94 (105)
                      ..|.++.|=+-...| .=.++..|++||.|
T Consensus        19 k~CP~~~CG~GvFMA-~H~dR~~CGKCg~T   47 (47)
T PF01599_consen   19 KECPSPRCGAGVFMA-EHKDRHYCGKCGYT   47 (47)
T ss_dssp             EE-TSTTTTSSSEEE-E-SSEEEETTTSS-
T ss_pred             hcCCCcccCCceEee-ecCCCccCCCcccC
Confidence            588888888754333 33689999999975


No 82 
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=26.26  E-value=24  Score=21.96  Aligned_cols=14  Identities=43%  Similarity=0.961  Sum_probs=5.8

Q ss_pred             hhhhccCCcCCCCC
Q psy13474         83 VEQSVCGACGATSE   96 (105)
Q Consensus        83 ~Eq~vC~~Cg~~S~   96 (105)
                      .-+.+|+-||+|++
T Consensus        31 Lr~y~Cp~CgAtGd   44 (55)
T PF05741_consen   31 LRKYVCPICGATGD   44 (55)
T ss_dssp             GGG---TTT---GG
T ss_pred             HhcCcCCCCcCcCc
Confidence            34579999999976


No 83 
>PTZ00183 centrin; Provisional
Probab=25.98  E-value=73  Score=21.31  Aligned_cols=28  Identities=18%  Similarity=0.424  Sum_probs=23.5

Q ss_pred             CHHHhhhhhhcCCCCCChHHHHHHHHhh
Q psy13474          1 MQELFSQLQSSHESALPPDALRRALAEA   28 (105)
Q Consensus         1 l~~iF~~~~~s~~~~l~p~~LR~ALa~~   28 (105)
                      ++.+|..++.+...-|+...++.+|...
T Consensus        19 ~~~~F~~~D~~~~G~i~~~e~~~~l~~~   46 (158)
T PTZ00183         19 IREAFDLFDTDGSGTIDPKELKVAMRSL   46 (158)
T ss_pred             HHHHHHHhCCCCCCcccHHHHHHHHHHh
Confidence            4678888888888899999999999864


No 84 
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=25.15  E-value=27  Score=20.99  Aligned_cols=17  Identities=29%  Similarity=0.645  Sum_probs=12.4

Q ss_pred             chhhhhhcceehhhhccCCcCCC
Q psy13474         72 CIPHEKFAMTLVEQSVCGACGAT   94 (105)
Q Consensus        72 Ci~H~~F~m~l~Eq~vC~~Cg~~   94 (105)
                      |.-+.++|+      .|+.||.|
T Consensus         2 C~~~~ltG~------~CPgCG~t   18 (52)
T PF10825_consen    2 CPFKALTGI------PCPGCGMT   18 (52)
T ss_pred             CcchhhhCC------CCCCCcHH
Confidence            666666665      49999976


No 85 
>PF12994 DUF3878:  Domain of unknown function, E. rectale Gene description (DUF3878);  InterPro: IPR024538 This entry represents proteins of unknown function found primarily in Firmicutes. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture []. 
Probab=24.98  E-value=28  Score=28.55  Aligned_cols=11  Identities=45%  Similarity=0.649  Sum_probs=9.7

Q ss_pred             ccCcHHHHHHH
Q psy13474         39 FMDDAAECFEN   49 (105)
Q Consensus        39 ~M~DA~E~fe~   49 (105)
                      .||||.|+|..
T Consensus        32 lMNDAVEsfLv   42 (299)
T PF12994_consen   32 LMNDAVESFLV   42 (299)
T ss_pred             ehhhhhhhhee
Confidence            69999999965


No 86 
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=24.84  E-value=47  Score=16.20  Aligned_cols=18  Identities=33%  Similarity=0.516  Sum_probs=14.3

Q ss_pred             hcccccCcHHHHHHHHHH
Q psy13474         35 FQLGFMDDAAECFENMLL   52 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~   52 (105)
                      .+.|.+++|.++|..+..
T Consensus        11 ~~~~~~~~a~~~~~~M~~   28 (35)
T TIGR00756        11 CKAGRVEEALELFKEMLE   28 (35)
T ss_pred             HHCCCHHHHHHHHHHHHH
Confidence            457899999999988654


No 87 
>PF13371 TPR_9:  Tetratricopeptide repeat
Probab=23.58  E-value=43  Score=19.63  Aligned_cols=21  Identities=38%  Similarity=0.374  Sum_probs=17.7

Q ss_pred             hhhcccccCcHHHHHHHHHHH
Q psy13474         33 QRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        33 ~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      -.++.|....|.++|+.+++.
T Consensus        38 ~~~~~g~~~~A~~~l~~~l~~   58 (73)
T PF13371_consen   38 CLFQLGRYEEALEDLERALEL   58 (73)
T ss_pred             HHHHhccHHHHHHHHHHHHHH
Confidence            457889999999999999853


No 88 
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=23.49  E-value=49  Score=20.95  Aligned_cols=31  Identities=19%  Similarity=0.418  Sum_probs=26.7

Q ss_pred             hhccCCCCchhhhhhcceehhhhccCCcCCC
Q psy13474         64 EDMCGAKHCIPHEKFAMTLVEQSVCGACGAT   94 (105)
Q Consensus        64 ~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~   94 (105)
                      -+.|++..|..=+-=....-|.-+|+-|+..
T Consensus        18 VW~Ct~e~C~gWmR~nFs~~~~p~CPlC~s~   48 (59)
T PF14169_consen   18 VWECTSEDCNGWMRDNFSFEEEPVCPLCKSP   48 (59)
T ss_pred             eEEeCCCCCCcccccccccCCCccCCCcCCc
Confidence            3699999999988877788899999999864


No 89 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=23.35  E-value=51  Score=22.89  Aligned_cols=19  Identities=32%  Similarity=0.746  Sum_probs=14.6

Q ss_pred             ceehhhhccCCcCCCCCCCC
Q psy13474         80 MTLVEQSVCGACGATSEPLP   99 (105)
Q Consensus        80 m~l~Eq~vC~~Cg~~S~p~~   99 (105)
                      |+- .-.||++||.+..+.+
T Consensus        22 Lnk-~PivCP~CG~~~~~~~   40 (108)
T PF09538_consen   22 LNK-DPIVCPKCGTEFPPEP   40 (108)
T ss_pred             CCC-CCccCCCCCCccCccc
Confidence            444 5578999999988874


No 90 
>PF13414 TPR_11:  TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A ....
Probab=23.27  E-value=60  Score=18.81  Aligned_cols=23  Identities=35%  Similarity=0.403  Sum_probs=19.3

Q ss_pred             hhhhhcccccCcHHHHHHHHHHH
Q psy13474         31 DQQRFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        31 ~~~~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ....|+.|+.++|.+.|...++.
T Consensus        10 g~~~~~~~~~~~A~~~~~~ai~~   32 (69)
T PF13414_consen   10 GQIYFQQGDYEEAIEYFEKAIEL   32 (69)
T ss_dssp             HHHHHHTTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHc
Confidence            44568899999999999998886


No 91 
>PF12895 Apc3:  Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A.
Probab=22.96  E-value=38  Score=20.84  Aligned_cols=19  Identities=21%  Similarity=0.392  Sum_probs=14.1

Q ss_pred             hhhhhcccccCcHHHHHHH
Q psy13474         31 DQQRFQLGFMDDAAECFEN   49 (105)
Q Consensus        31 ~~~~Fq~G~M~DA~E~fe~   49 (105)
                      ..-.+++|+.++|.++|+.
T Consensus        65 a~~~~~l~~y~eAi~~l~~   83 (84)
T PF12895_consen   65 ARCLLKLGKYEEAIKALEK   83 (84)
T ss_dssp             HHHHHHTT-HHHHHHHHHH
T ss_pred             HHHHHHhCCHHHHHHHHhc
Confidence            4557888888888888875


No 92 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=22.59  E-value=1.1e+02  Score=23.54  Aligned_cols=20  Identities=15%  Similarity=-0.039  Sum_probs=14.7

Q ss_pred             hhcccccCcHHHHHHHHHHH
Q psy13474         34 RFQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        34 ~Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ..+.|+.++|.+.|+.+++.
T Consensus       292 ~~~~g~~~~A~~~l~~~l~~  311 (389)
T PRK11788        292 LEEQEGPEAAQALLREQLRR  311 (389)
T ss_pred             HHHhCCHHHHHHHHHHHHHh
Confidence            34568888888888877665


No 93 
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=21.84  E-value=36  Score=25.28  Aligned_cols=29  Identities=28%  Similarity=0.531  Sum_probs=21.6

Q ss_pred             ccCCCCchhhh-----hhcceehh---hhccCCcCCC
Q psy13474         66 MCGAKHCIPHE-----KFAMTLVE---QSVCGACGAT   94 (105)
Q Consensus        66 ~c~~~~Ci~H~-----~F~m~l~E---q~vC~~Cg~~   94 (105)
                      -|.+|.||+|.     +|...=-+   ...|..|+.+
T Consensus       105 kC~Np~CIT~~E~v~~~F~v~~~~~~~~lrC~YCe~~  141 (150)
T TIGR00240       105 KCPNPNCISNAEPVSSKFYVRSEEPDIALRCYYCEKE  141 (150)
T ss_pred             ECCCCCCccCCCCCCcEEEEecCCCceEEEEECCCCE
Confidence            89999999984     56554344   3789999865


No 94 
>PF13374 TPR_10:  Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A.
Probab=21.58  E-value=1e+02  Score=15.73  Aligned_cols=25  Identities=20%  Similarity=0.093  Sum_probs=16.2

Q ss_pred             hhcccccCcHHHHHHHHHHHhhhcc
Q psy13474         34 RFQLGFMDDAAECFENMLLRIHYHI   58 (105)
Q Consensus        34 ~Fq~G~M~DA~E~fe~IL~~lH~~~   58 (105)
                      .+..|+.++|.+.++.+++.--..+
T Consensus        12 ~~~~g~~~~A~~~~~~al~~~~~~~   36 (42)
T PF13374_consen   12 YRAQGRYEEALELLEEALEIRERLL   36 (42)
T ss_dssp             HHHCT-HHHHHHHHHHHHHHH----
T ss_pred             HHhhhhcchhhHHHHHHHHHHHHHh
Confidence            4557999999999999887654443


No 95 
>PF14559 TPR_19:  Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A ....
Probab=21.14  E-value=49  Score=19.07  Aligned_cols=19  Identities=37%  Similarity=0.487  Sum_probs=13.7

Q ss_pred             hcccccCcHHHHHHHHHHH
Q psy13474         35 FQLGFMDDAAECFENMLLR   53 (105)
Q Consensus        35 Fq~G~M~DA~E~fe~IL~~   53 (105)
                      ++.|+.++|.+.|+.++..
T Consensus         2 l~~~~~~~A~~~~~~~l~~   20 (68)
T PF14559_consen    2 LKQGDYDEAIELLEKALQR   20 (68)
T ss_dssp             HHTTHHHHHHHHHHHHHHH
T ss_pred             hhccCHHHHHHHHHHHHHH
Confidence            4567777788888777755


No 96 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=20.94  E-value=32  Score=19.62  Aligned_cols=8  Identities=38%  Similarity=1.095  Sum_probs=3.8

Q ss_pred             hccCCcCC
Q psy13474         86 SVCGACGA   93 (105)
Q Consensus        86 ~vC~~Cg~   93 (105)
                      ..|..||.
T Consensus        27 ~~CP~Cg~   34 (42)
T PF09723_consen   27 VPCPECGS   34 (42)
T ss_pred             CcCCCCCC
Confidence            34555554


No 97 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=20.94  E-value=47  Score=18.36  Aligned_cols=11  Identities=55%  Similarity=1.280  Sum_probs=7.9

Q ss_pred             hccCCcCCCCC
Q psy13474         86 SVCGACGATSE   96 (105)
Q Consensus        86 ~vC~~Cg~~S~   96 (105)
                      .+|+.||++-+
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            36888998766


No 98 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=20.36  E-value=65  Score=27.49  Aligned_cols=31  Identities=23%  Similarity=0.380  Sum_probs=24.0

Q ss_pred             hhhhhcccccCcHHHHHHHHHHHhhhccCCc
Q psy13474         31 DQQRFQLGFMDDAAECFENMLLRIHYHIASE   61 (105)
Q Consensus        31 ~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~   61 (105)
                      .-+.|..|...||.++|..||..|=.-+..+
T Consensus       211 gyk~~t~gKF~eA~~~Fr~iL~~i~l~vv~~  241 (422)
T PF06957_consen  211 GYKLFTAGKFEEAIEIFRSILHSIPLLVVES  241 (422)
T ss_dssp             HHHHHHTT-HHHHHHHHHHHHHHHHC--BSS
T ss_pred             HHHHHhcCCHHHHHHHHHHHHHHhheeeecC
Confidence            3477999999999999999999987766554


No 99 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=20.35  E-value=49  Score=17.94  Aligned_cols=13  Identities=23%  Similarity=0.606  Sum_probs=9.5

Q ss_pred             hhhhccCCcCCCC
Q psy13474         83 VEQSVCGACGATS   95 (105)
Q Consensus        83 ~Eq~vC~~Cg~~S   95 (105)
                      -+..+|..||++.
T Consensus        24 ~~~~~CP~Cg~~~   36 (41)
T smart00834       24 DPLATCPECGGDV   36 (41)
T ss_pred             CCCCCCCCCCCcc
Confidence            4567899998854


No 100
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=20.22  E-value=1.4e+02  Score=27.01  Aligned_cols=74  Identities=19%  Similarity=0.225  Sum_probs=55.4

Q ss_pred             CCChHHHHHHHHhhchhhhhhcccccCcHHHHHHHHHHHhhhccCCchhhhccCCCCchhhhhhcceehhhhccCCcCCC
Q psy13474         15 ALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGAT   94 (105)
Q Consensus        15 ~l~p~~LR~ALa~~~~~~~~Fq~G~M~DA~E~fe~IL~~lH~~~~~~~~~d~c~~~~Ci~H~~F~m~l~Eq~vC~~Cg~~   94 (105)
                      .|.|..+..-+..   +-+-|..-+--||-|-|.-+|+.|-....+...++       |+ .+|-+.+=.+..|..|+..
T Consensus       372 gi~p~~fk~~igq---~h~eFg~~~QQDA~EFLlfLL~kirk~~~S~~~~~-------It-~lf~Fe~e~rlsC~~C~~v  440 (749)
T COG5207         372 GISPLDFKMLIGQ---DHPEFGKFAQQDAHEFLLFLLEKIRKGERSYLIPP-------IT-SLFEFEVERRLSCSGCMDV  440 (749)
T ss_pred             CcChhhHHHHHcC---CchhhhhhhhhhHHHHHHHHHHHHhhccchhcCCC-------cc-hhhhhhhcceecccccccc
Confidence            4677777776654   66778888889999999999999988544322111       55 7899888888999999987


Q ss_pred             CCCCC
Q psy13474         95 SEPLP   99 (105)
Q Consensus        95 S~p~~   99 (105)
                      +--.|
T Consensus       441 ~ySye  445 (749)
T COG5207         441 SYSYE  445 (749)
T ss_pred             ccccc
Confidence            75443


Done!