BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13476
         (177 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
 pdb|2Y6E|B Chain B, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
 pdb|2Y6E|C Chain C, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
 pdb|2Y6E|D Chain D, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
 pdb|2Y6E|E Chain E, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
 pdb|2Y6E|F Chain F, Ubiquitin Specific Protease 4 Is Inhibited By Its
           Ubiquitin- Like Domain
          Length = 367

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 119 NAAASTPLHQLVGVVTYYGK----HYSTFFFHTKLKVWIYFDDATV 160
           N +A   ++ L+ V  +YG     HY+ +  +     W YFDD+ V
Sbjct: 292 NLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNV 337


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,230,395
Number of Sequences: 62578
Number of extensions: 195047
Number of successful extensions: 327
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 327
Number of HSP's gapped (non-prelim): 1
length of query: 177
length of database: 14,973,337
effective HSP length: 92
effective length of query: 85
effective length of database: 9,216,161
effective search space: 783373685
effective search space used: 783373685
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)