Diaphorina citri psyllid: psy13490


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MYKLKANPKFQHSDHQVCFFPHNIQILGGHRIPFDIYVDPFMHEVTHFCLPPLKDLLKVSVRHVHQMFEFFEETLSNRYPYPCYKQVFVDSTVTDVTAYASMSILSSDSPVLWIRLDPEMTIIRSVVIEQPDYQWHFS
cCEECcccccEEEEEEEccccccccEEEEEECcEEEECcccccCEEEECccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccEEEEECcccccccccccccHHHHHHHHHHHccccccccc
*******PKFQHSDHQVCFFPHNIQILGGHRIPFDIYVDPFMHEVTHFCLPPLKDLLKVSVRHVHQMFEFFEETLSNRYPYPCYKQVFVDSTVTDVTAYASMSILSSDSPVLWIRLDPEMTIIRSVVIEQPDYQWHFS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYKLKANPKFQHSDHQVCFFPHNIQILGGHRIPFDIYVDPFMHEVTHFCLPPLKDLLKVSVRHVHQMFEFFEETLSNRYPYPCYKQVFVDSTVTDVTAYASMSILSSDSPVLWIRLDPEMTIIRSVVIEQPDYQWHFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription initiation factor TFIID subunit 2 Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It requires core promoter-specific cofactors for productive transcription stimulation. TAF2 stabilizes TFIID binding to core promoter.confidentQ32PW3
Transcription initiation factor TFIID subunit 2 TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. An essential subunit binds to core promoter DNA.confidentQ24325
Transcription initiation factor TFIID subunit 2 Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It requires core promoter-specific cofactors for productive transcription stimulation. TAF2 stabilizes TFIID binding to core promoter.confidentQ5ZIT8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001075 [MF]RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity involved in preinitiation complex assemblyprobableGO:0003700, GO:0003674, GO:0000983, GO:0001071, GO:0000981
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0005669 [CC]transcription factor TFIID complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0033276 [CC]transcription factor TFTC complexprobableGO:0030880, GO:0044464, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0000123, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043231, GO:0043234, GO:0032991, GO:0031981, GO:0043233, GO:0000428, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0070461, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EBH, chain A
Confidence level:confident
Coverage over the Query: 5-137
View the alignment between query and template
View the model in PyMOL