Diaphorina citri psyllid: psy13513


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MEEEEREKMQVLVSNFTEDQLDRYEMYRRAAFPKAAIKRLIQTISGGSVSQNVVIAMSGIAKVFVGEIVEQ
ccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccc
***********LVSNFTEDQLDRYEMYRRAAFPKAAIKRLIQTISGGSVSQNVVIAMSGIAKVFVGEIVEQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEEREKMQVLVSNFTEDQLDRYEMYRRAAFPKAAIKRLIQTISGGSVSQNVVIAMSGIAKVFVGEIVEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription initiation factor TFIID subunit 11 Core TAFII present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).confidentQ99JX1
Transcription initiation factor TFIID subunit 11 Core TAFII present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).confidentQ5RA91
Transcription initiation factor TFIID subunit 11 Core TAFII present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).confidentQ15544

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionconfident
GO:0001075 [MF]RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity involved in preinitiation complex assemblyprobableGO:0003700, GO:0003674, GO:0000983, GO:0001071, GO:0000981
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005669 [CC]transcription factor TFIID complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0043923 [BP]positive regulation by host of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0044403, GO:0052472, GO:0050434, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:0051851, GO:0044419, GO:0019219, GO:0051817, GO:0046782, GO:0031326, GO:0048518, GO:0065007, GO:0065008, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0043921, GO:2001141, GO:0051702, GO:0051704, GO:0052312, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0035821, GO:0048522
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0046966 [MF]thyroid hormone receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042809 [MF]vitamin D receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BH9, chain B
Confidence level:very confident
Coverage over the Query: 16-71
View the alignment between query and template
View the model in PyMOL