Diaphorina citri psyllid: psy13517


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MDSFLLNNNKGLGFFRGSRTSSERDPLIKLSRENSKLIDAAYTKNQAWKSDADTLHAPPAEEVSFEEHCKYKYLFNFRGVAASFRFKHLFLCKSLVFHVGDEWIEFFYPAMKPWVSHLKNIARDEWIEFFYPAMKPWVHYVPVNKHASKQEIRDMLHFFMHHDDVAEKIATRGYEFVMKNLKMKHVTQYWEVLLSKYAALLKYKPRLQK
ccccccccccccEEEcccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHcccEEEEEEccccccccHHHHHHcccEEEEEccccHHHHHcccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccc
MDSFLLNNNKGLGFFRGSRTSSERDPLIKLSRENSKLIDAAYTKNQAWKSDADTLHAPPAEEVSFEEHCKYKYLFNFRGVAASFRFKHLFLCKSLVFHVGDEWIEFFYPAMKPWVSHLKNIARDEWIEFFYPAMKPWVHYVPVNKHASKQEIRDMLHFFMHHDDVAEKIATRGYEFVMKNLKMKHVTQYWEVLLSKYAALLKYKP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSFLLNNNKGLGFFRGSRTSSERDPLIKLSRENSKLIDAAYTKNQAWKSDADTLHAPPAEEVSFEEHCKYKYLFNFRGVAASFRFKHLFLCKSLVFHVGDEWIEFFYPAMKPWVSHLKNIARDEWIEFFYPAMKPWVHYVPVNKHASKQEIRDMLHFFMHHDDVAEKIATRGYEFVMKNLKMKHVTQYWEVLLSKYAALLKYKPRLQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
O-glucosyltransferase rumi Protein O-glucosyltransferase. Catalyzes the reaction that attaches glucose through an O-glycosidic linkage to a conserved serine residue in epidermal growth factor-like repeats. Regulates Notch signaling by glucosylating Notch in the ER, glucosylation is required for the correct folding and cleavage of Notch.confidentQ8T045
Protein O-glucosyltransferase 1 UDP-glucosyltransferase.confidentQ8BYB9
Protein O-glucosyltransferase 1 UDP-glucosyltransferase.confidentQ5E9Q1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035251 [MF]UDP-glucosyltransferase activityprobableGO:0046527, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:2000035 [BP]regulation of stem cell divisionprobableGO:0050789, GO:0008150, GO:0065007, GO:0051302, GO:0050794
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0045747 [BP]positive regulation of Notch signaling pathwayprobableGO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0007030 [BP]Golgi organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0033577 [BP]protein glycosylation in endoplasmic reticulumprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JJM, chain A
Confidence level:probable
Coverage over the Query: 81-104,131-196
View the alignment between query and template
View the model in PyMOL
Template: 2GEK, chain A
Confidence level:probable
Coverage over the Query: 69-107,135-205
View the alignment between query and template
View the model in PyMOL