Diaphorina citri psyllid: psy13557


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MDHHCPWINNCVSYANYKFFVLFLTYGVLYFGFILTTMILSMTKVKSDHFWLVFTLSRCFPLLLLAASLTTVKLALLAYHIYLMLHNRTTLDAYRAPQFNYGPDRNGFDLGKRNNFYQVFGKDRLLWFFPVFSSLGNGWSFPTRADYAFAESGGFDKLYEPDEKEKLIPK
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
MDHHCPWINNCVSYANYKFFVLFLTYGVLYFGFILTTMILSMTKVKSDHFWLVFTLSRCFPLLLLAASLTTVKLALLAYHIYLMLHNRTTLDAYRAPQFNYGPDRNGFDLGKRNNFYQVFGKDRLLWFFPVFSSLGNGWSFPTRAD************************
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHHCPWINNCVSYANYKFFVLFLTYGVLYFGFILTTMILSMTKVKSDHFWLVFTLSRCFPLLLLAASLTTVKLALLAYHIYLMLHNRTTLDAYRAPQFNYGPDRNGFDLGKRNNFYQVFGKDRLLWFFPVFSSLGNGWSFPTRADYAFAESGGFDKLYEPDEKEKLIPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016409 [MF]palmitoyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0018345 [BP]protein palmitoylationprobableGO:0044249, GO:0042157, GO:0034645, GO:1901576, GO:0042158, GO:0043543, GO:0044260, GO:0071704, GO:0044267, GO:0009987, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0009059
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted