Diaphorina citri psyllid: psy13558

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MKTIDGKPEFKGAFDVLGKVIKQEGVLALWKGFMPYFLRIGPHTVLTFIFLEQMCIFYNKKFMGNTSGKGSGM
ccccccccccccHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*********FKGAFDVLGKVIKQEGVLALWKGFMPYFLRIGPHTVLTFIFLEQMCIFYNKKFM**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTIDGKPEFKGAFDVLGKVIKQEGVLALWKGFMPYFLRIGPHTVLTFIFLEQMCIFYNKKFMGNTSGKGSGM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial 2-oxoglutarate/malate carrier protein Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.confidentQ02978
Probable mitochondrial 2-oxoglutarate/malate carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.confidentQ54PY7
Mitochondrial 2-oxoglutarate/malate carrier protein Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.confidentP22292

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0071423 [BP]malate transmembrane transportprobableGO:0009987, GO:0006820, GO:0051234, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0006835, GO:0046942, GO:0015743, GO:0055085, GO:0044699, GO:0015740
GO:1901677 [MF]phosphate transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035435 [BP]phosphate ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0006817, GO:0044765, GO:0051179, GO:0008150, GO:0034220, GO:0006820, GO:0044763, GO:0015698, GO:0051234, GO:0055085, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015116 [MF]sulfate transmembrane transporter activityprobableGO:0022891, GO:1901682, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015103
GO:0015117 [MF]thiosulfate transmembrane transporter activityprobableGO:0022891, GO:1901682, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015103
GO:0008272 [BP]sulfate transportprobableGO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0015709 [BP]thiosulfate transportprobableGO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0015140 [MF]malate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0015556, GO:0005310, GO:0008509, GO:0015075, GO:0008514, GO:0022857, GO:0003674, GO:0005215, GO:0046943
GO:0015291 [MF]secondary active transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674, GO:0022804

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 6-59
View the alignment between query and template
View the model in PyMOL