RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy13569
(118 letters)
>gnl|CDD|241415 cd13261, PH_RasGRF1_2, Ras-specific guanine nucleotide-releasing
factors 1 and 2 Pleckstrin homology (PH) domain.
RasGRF1 (also called GRF1; CDC25Mm/Ras-specific
nucleotide exchange factor CDC25; GNRP/Guanine
nucleotide-releasing protein) and RasGRF2 (also called
GRF2; Ras guanine nucleotide exchange factor 2) are a
family of guanine nucleotide exchange factors (GEFs).
They both promote the exchange of Ras-bound GDP by GTP,
thereby regulating the RAS signaling pathway. RasGRF1
and RasGRF2 form homooligomers and heterooligomers.
GRF1 has 3 isoforms and GRF2 has 2 isoforms. The
longest isoforms of RasGRF1 and RasGRF2 contain the
following domains: a Rho-GEF domain sandwiched between
2 PH domains, IQ domains, a REM (Ras exchanger motif)
domain, and a Ras-GEF domainwhich gives them the
capacity to activate both Ras and Rac GTPases in
response to signals from a variety of neurotransmitter
receptors. Their IQ domains allow them to act as
calcium sensors to mediate the actions of NMDA-type and
calcium-permeable AMPA-type glutamate receptors. GRF1
also mediates the action of dopamine receptors that
signal through cAMP. GRF1 and GRF2 play strikingly
different roles in regulating MAP kinase family
members, neuronal synaptic plasticity, specific forms
of learning and memory, and behavioral responses to
psychoactive drugs. PH domains have diverse functions,
but in general are involved in targeting proteins to
the appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 136
Score = 58.2 bits (141), Expect = 5e-12
Identities = 16/31 (51%), Positives = 23/31 (74%)
Query: 67 AKYDHSLSGYLEKRTSDQARWQTRWFVLYQN 97
A+ D + GYL K++SD ++W T+WF LYQN
Sbjct: 1 ARKDGTRRGYLSKKSSDNSKWHTKWFALYQN 31
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
Pleckstrin homology (PH) domain. The binding of TAPP2
(also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
not PI(3,4, 5)P3, function as negative regulators of
insulin and PI3K signalling pathways (i.e.
TAPP/utrophin/syntrophin complex). TAPP2 contains two
sequential PH domains in which the C-terminal PH domain
specifically binds PtdIns(3,4)P2 with high affinity. The
N-terminal PH domain does not interact with any
phosphoinositide tested. They also contain a C-terminal
PDZ-binding motif that interacts with several
PDZ-binding proteins, including PTPN13 (known previously
as PTPL1 or FAP-1) as well as the scaffolding proteins
MUPP1 (multiple PDZ-domain-containing protein 1),
syntrophin and utrophin. The members here are most
sequence similar to TAPP2 proteins, but may not be
actual TAPP2 proteins. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 35.1 bits (81), Expect = 0.002
Identities = 13/29 (44%), Positives = 18/29 (62%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
+GYLEK+ + W+ RWFVL K+ Y
Sbjct: 9 AGYLEKKGERRKTWKKRWFVLRPTKLAYY 37
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
domain, repeat 1. Pleckstrin is a protein found in
platelets. This name is derived from platelet and
leukocyte C kinase substrate and the KSTR string of
amino acids. Pleckstrin 2 contains two PH domains and a
DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
pleckstrin 1, pleckstrin 2 does not contain obvious
sites of PKC phosphorylation. Pleckstrin 2 plays a role
in actin rearrangement, large lamellipodia and
peripheral ruffle formation, and may help orchestrate
cytoskeletal arrangement. The PH domains of pleckstrin 2
are thought to contribute to lamellipodia formation.
This cd contains the first PH domain repeat. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 108
Score = 34.3 bits (79), Expect = 0.003
Identities = 11/28 (39%), Positives = 17/28 (60%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQNKVIAY 102
G+L K+ W+ RWFVL ++K+ Y
Sbjct: 7 GFLVKKGHVVNNWKARWFVLLEDKLEYY 34
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
3-Phosphoinositides Pleckstrin homology (PH) domain.
DAPP1 (also known as PHISH/3'
phosphoinositide-interacting SH2 domain-containing
protein or Bam32) plays a role in B-cell activation and
has potential roles in T-cell and mast cell function.
DAPP1 promotes B cell receptor (BCR) induced activation
of Rho GTPases Rac1 and Cdc42, which feed into
mitogen-activated protein kinases (MAPK) activation
pathways and affect cytoskeletal rearrangement.
DAPP1can also regulate BCR-induced activation of
extracellular signal-regulated kinase (ERK), and c-jun
NH2-terminal kinase (JNK). DAPP1 contains an N-terminal
SH2 domain and a C-terminal pleckstrin homology (PH)
domain with a single tyrosine phosphorylation site
located centrally. DAPP1 binds strongly to both
PtdIns(3,4,5)P3 and PtdIns(3,4)P2. The PH domain is
essential for plasma membrane recruitment of PI3K upon
cell activation. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 30.7 bits (70), Expect = 0.063
Identities = 13/27 (48%), Positives = 17/27 (62%)
Query: 72 SLSGYLEKRTSDQARWQTRWFVLYQNK 98
S GYL K+ W+TRWFVL +N+
Sbjct: 4 SKEGYLTKQGGIVKNWKTRWFVLRKNE 30
>gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain
containing/faciogenital dysplasia protein 4 pleckstrin
homology (PH) domain, C-terminus, in insect and related
arthropods. In general, FGDs have a RhoGEF (DH) domain,
followed by an N-terminal PH domain, a FYVE domain and a
C-terminal PH domain. All FGDs are guanine nucleotide
exchange factors that activates the Rho GTPase Cdc42, an
important regulator of membrane trafficking. The RhoGEF
domain is responsible for GEF catalytic activity, while
the N-terminal PH domain is involved in intracellular
targeting of the DH domain. FGD4 is one of the genes
associated with Charcot-Marie-Tooth neuropathy type 4
(CMT4), a group of progressive motor and sensory axonal
and demyelinating neuropathies that are distinguished
from other forms of CMT by autosomal recessive
inheritance. Those affected have distal muscle weakness
and atrophy associated with sensory loss and,
frequently, pes cavus foot deformity. This cd contains
insects, crustaceans, and chelicerates. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 30.3 bits (68), Expect = 0.072
Identities = 12/28 (42%), Positives = 19/28 (67%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQNKVI 100
LSGYL+ +T+ + W RWF L+ + V+
Sbjct: 1 LSGYLKLKTNGRKTWIRRWFALHPDFVL 28
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin
homology (PH) domain. RhoGAP2 (also called RhoGap22 or
ArhGap22) are involved in cell polarity, cell morphology
and cytoskeletal organization. They activate a GTPase
belonging to the RAS superfamily of small GTP-binding
proteins. The encoded protein is insulin-responsive, is
dependent on the kinase Akt, and requires the
Akt-dependent 14-3-3 binding protein which binds
sequentially to two serine residues resulting in
regulation of cell motility. Members here contain an
N-terminal PH domain followed by a RhoGAP domain and
either a BAR or TATA Binding Protein (TBP) Associated
Factor 4 (TAF4) domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 116
Score = 30.7 bits (69), Expect = 0.073
Identities = 12/29 (41%), Positives = 19/29 (65%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
+G+L+K+ S WQ RWFVL +++ Y
Sbjct: 6 AGWLKKQRSIMKNWQQRWFVLRGDQLFYY 34
>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein
homologs 1 and 2 Pleckstrin homology (PH) domain. Yeast
Osh1p is proposed to function in postsynthetic sterol
regulation, piecemeal microautophagy of the nucleus, and
cell polarity establishment. Yeast Osh2p is proposed to
function in sterol metabolism and cell polarity
establishment. Both Osh1p and Osh2p contain 3 N-terminal
ankyrin repeats, a PH domain, a FFAT motif (two
phenylalanines in an acidic tract), and a C-terminal
OSBP-related domain. OSBP andOsh1p PH domains
specifically localize to the Golgi apparatus in a
PtdIns4P-dependent manner. Oxysterol binding proteins
are a multigene family that is conserved in yeast,
flies, worms, mammals and plants. In general OSBPs and
ORPs have been found to be involved in the transport and
metabolism of cholesterol and related lipids in
eukaryotes. They all contain a C-terminal oxysterol
binding domain, and most contain an N-terminal PH
domain. OSBP PH domains bind to membrane
phosphoinositides and thus likely play an important role
in intracellular targeting. They are members of the
oxysterol binding protein (OSBP) family which includes
OSBP, OSBP-related proteins (ORP), Goodpasture antigen
binding protein (GPBP), and Four phosphate adaptor
protein 1 (FAPP1). They have a wide range of purported
functions including sterol transport, cell cycle
control, pollen development and vessicle transport from
Golgi recognize both PI lipids and ARF proteins. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 103
Score = 30.4 bits (69), Expect = 0.084
Identities = 13/31 (41%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
Query: 72 SLSGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
++ GYL+K T+ ++TRWFVL ++ V++Y
Sbjct: 3 TMKGYLKKWTNYAKGYKTRWFVL-EDGVLSY 32
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
(PH) domain. SH3BP2 (the gene that encodes the adaptor
protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
near the Huntington's Disease Gene on Human Chromosome
4pl6.3. SH3BP2 lies in a region that is often missing in
individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
function mutations in SH3BP2 causes enhanced B-cell
antigen receptor (BCR)-mediated activation of nuclear
factor of activated T cells (NFAT), resulting in a rare,
genetic disorder called cherubism. This results in an
increase in the signaling complex formation with Syk,
phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
recently discovered that Tankyrase regulates 3BP2
stability through ADP-ribosylation and ubiquitylation by
the E3-ubiquitin ligase. Cherubism mutations uncouple
3BP2 from Tankyrase-mediated protein destruction, which
results in its stabilization and subsequent
hyperactivation of the Src, Syk, and Vav signaling
pathways. SH3BP2 is also a potential negative regulator
of the abl oncogene. PH domains have diverse functions,
but in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 113
Score = 30.4 bits (69), Expect = 0.089
Identities = 10/37 (27%), Positives = 19/37 (51%), Gaps = 3/37 (8%)
Query: 69 YDHSLSGYLEKRTSDQ---ARWQTRWFVLYQNKVIAY 102
D + SGYL K+ Q +W R+ ++++ V +
Sbjct: 7 RDVTHSGYLTKKGGSQKQLLKWPLRYVIIHKGCVYYF 43
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain. There
are 2 members of the evectin family (also called
pleckstrin homology domain containing, family B): evt-1
(also called PLEKHB1) and evt-2 (also called PLEKHB2).
evt-1 is specific to the nervous system, where it is
expressed in photoreceptors and myelinating glia. evt-2
is widely expressed in both neural and nonneural
tissues. Evectins possess a single N-terminal PH domain
and a C-terminal hydrophobic region. evt-1 is thought to
function as a mediator of post-Golgi trafficking in
cells that produce large membrane-rich organelles. It is
a candidate gene for the inherited human retinopathy
autosomal dominant familial exudative vitreoretinopathy
and a susceptibility gene for multiple sclerosis. evt-2
is essential for retrograde endosomal membrane transport
from the plasma membrane (PM) to the Golgi. Two membrane
trafficking pathways pass through recycling endosomes: a
recycling pathway and a retrograde pathway that links
the PM to the Golgi/ER. Its PH domain that is unique in
that it specifically recognizes phosphatidylserine (PS),
but not polyphosphoinositides. PS is an anionic
phospholipid class in eukaryotic biomembranes, is highly
enriched in the PM, and plays key roles in various
physiological processes such as the coagulation cascade,
recruitment and activation of signaling molecules, and
clearance of apoptotic cells. PH domains are only found
in eukaryotes. They share little sequence conservation,
but all have a common fold, which is electrostatically
polarized. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 108
Score = 30.3 bits (69), Expect = 0.096
Identities = 11/29 (37%), Positives = 20/29 (68%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
SG+L ++++ RW+ WFVLY + ++Y
Sbjct: 6 SGWLLRQSTILKRWKKNWFVLYSDGELSY 34
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein
family Pleckstrin homology (PH) domain. Skap adaptor
proteins couple receptors to cytoskeletal
rearrangements. Src kinase-associated phosphoprotein of
55 kDa (Skap55)/Src kinase-associated phosphoprotein 1
(Skap1), Skap2, and Skap-homology (Skap-hom) have an
N-terminal coiled-coil conformation, a central PH domain
and a C-terminal SH3 domain. Their PH domains bind
3'-phosphoinositides as well as directly affecting
targets such as in Skap55 where it directly affecting
integrin regulation by ADAP and NF-kappaB activation or
in Skap-hom where the dimerization and PH domains
comprise a 3'-phosphoinositide-gated molecular switch
that controls ruffle formation. PH domains are only
found in eukaryotes. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 30.1 bits (68), Expect = 0.11
Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 14/49 (28%)
Query: 74 SGYLEKRTSDQA----RWQTRWFVLYQNKVIAYCWSKGTFQSYASSIGK 118
GYLEKR D + WQ RW VL S F Y S K
Sbjct: 4 QGYLEKRRKDHSFFGSEWQKRWCVL----------SNTAFYYYGSEKDK 42
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and
related proteins Pleckstrin homology (PH) domain.
RhoGAP25 (also called ArhGap25) like other RhoGaps are
involved in cell polarity, cell morphology and
cytoskeletal organization. They act as GTPase
activators for the Rac-type GTPases by converting them
to an inactive GDP-bound state and control actin
remodeling by inactivating Rac downstream of Rho
leading to suppress leading edge protrusion and
promotes cell retraction to achieve cellular polarity
and are able to suppress RAC1 and CDC42 activity in
vitro. Overexpression of these proteins induces cell
rounding with partial or complete disruption of actin
stress fibers and formation of membrane ruffles,
lamellipodia, and filopodia. This hierarchy contains
RhoGAP22, RhoGAP24, and RhoGAP25. Members here contain
an N-terminal PH domain followed by a RhoGAP domain and
either a BAR or TATA Binding Protein (TBP) Associated
Factor 4 (TAF4) domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold,
which is electrostatically polarized. Less than 10% of
PH domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 114
Score = 30.0 bits (68), Expect = 0.11
Identities = 11/21 (52%), Positives = 14/21 (66%)
Query: 74 SGYLEKRTSDQARWQTRWFVL 94
SG+L+K+ WQ RWFVL
Sbjct: 6 SGWLKKQGGIVKNWQRRWFVL 26
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain
containing/faciogenital dysplasia proteins 5 and 6
pleckstrin homology (PH) domain, C-terminus. FGD5
regulates promotes angiogenesis of vascular endothelial
growth factor (VEGF) in vascular endothelial cells,
including network formation, permeability, directional
movement, and proliferation. The specific function of
FGD6 is unknown. In general, FGDs have a RhoGEF (DH)
domain, followed by a PH domain, a FYVE domain and a
C-terminal PH domain. All FGDs are guanine nucleotide
exchange factors that activate the Rho GTPase Cdc42, an
important regulator of membrane trafficking. The RhoGEF
domain is responsible for GEF catalytic activity, while
the PH domain is involved in intracellular targeting of
the DH domain. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 90
Score = 29.7 bits (67), Expect = 0.15
Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQNKVI 100
+SGYL +R + W+ WFVL +KV+
Sbjct: 1 MSGYLYRRKRKKKSWKRLWFVLK-DKVL 27
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
domains Pleckstrin homology (PH) domain. ACAP (also
called centaurin beta) functions both as a Rab35
effector and as an Arf6-GTPase-activating protein (GAP)
by which it controls actin remodeling and membrane
trafficking. ACAP contain an NH2-terminal
bin/amphiphysin/Rvs (BAR) domain, a phospholipid-binding
domain, a PH domain, a GAP domain, and four ankyrin
repeats. The AZAPs constitute a family of Arf GAPs that
are characterized by an NH2-terminal pleckstrin homology
(PH) domain and a central Arf GAP domain followed by two
or more ankyrin repeats. On the basis of sequence and
domain organization, the AZAP family is further
subdivided into four subfamilies: 1) the ACAPs contain
an NH2-terminal bin/amphiphysin/Rvs (BAR) domain (a
phospholipid-binding domain that is thought to sense
membrane curvature), a single PH domain followed by the
GAP domain, and four ankyrin repeats; 2) the ASAPs also
contain an NH2-terminal BAR domain, the tandem PH
domain/GAP domain, three ankyrin repeats, two
proline-rich regions, and a COOH-terminal Src homology 3
domain; 3) the AGAPs contain an NH2-terminal GTPase-like
domain (GLD), a split PH domain, and the GAP domain
followed by four ankyrin repeats; and 4) the ARAPs
contain both an Arf GAP domain and a Rho GAP domain, as
well as an NH2-terminal sterile-a motif (SAM), a
proline-rich region, a GTPase-binding domain, and five
PH domains. PMID 18003747 and 19055940 Centaurin can
bind to phosphatidlyinositol (3,4,5)P3. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 98
Score = 29.5 bits (67), Expect = 0.17
Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 1/27 (3%)
Query: 75 GYLEKRTSDQAR-WQTRWFVLYQNKVI 100
GYL KR+S+ + W+ RWF + +++
Sbjct: 3 GYLFKRSSNAFKTWKRRWFSIQNGQLV 29
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat
2. MyoX, a MyTH-FERM myosin, is a molecular motor that
has crucial functions in the transport and/or tethering
of integrins in the actin-based extensions known as
filopodia, microtubule binding, and in netrin-mediated
axon guidance. It functions as a dimer. MyoX walks on
bundles of actin, rather than single filaments, unlike
the other unconventional myosins. MyoX is present in
organisms ranging from humans to choanoflagellates, but
not in Drosophila and Caenorhabditis elegans.MyoX
consists of a N-terminal motor/head region, a neck made
of 3 IQ motifs, and a tail consisting of a coiled-coil
domain, a PEST region, 3 PH domains, a myosin tail
homology 4 (MyTH4), and a FERM domain at its very
C-terminus. The first PH domain in the MyoX tail is a
split-PH domain, interupted by the second PH domain such
that PH 1a and PH 1b flanks PH 2. The third PH domain
(PH 3) follows the PH 1b domain. This cd contains the
second PH repeat. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 111
Score = 29.7 bits (67), Expect = 0.18
Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 5/43 (11%)
Query: 65 DRAKYDHSLSGYLEKRTSDQA-----RWQTRWFVLYQNKVIAY 102
R+K + SG+L K+ + W++RWFVL + Y
Sbjct: 1 FRSKQEALKSGWLYKKGGGSSTLSRKNWKSRWFVLRDTVLKYY 43
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
domain, repeat 1. The functions of these fungal
proteins are unknown, but they all contain 2 PH
domains. This cd represents the first PH repeat. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from
other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 29.5 bits (67), Expect = 0.19
Identities = 11/22 (50%), Positives = 14/22 (63%)
Query: 73 LSGYLEKRTSDQARWQTRWFVL 94
SG+L KR+ W+ RWFVL
Sbjct: 8 KSGWLLKRSRKTKTWKKRWFVL 29
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1
Pleckstrin homology (PH) domain. Adaptor protein Skap1
(also called Skap55/Src kinase-associated phosphoprotein
of 55 kDa) and its partner, ADAP (adhesion and
degranulation promoting adapter protein) help reorganize
the cytoskeleton and/or promote integrin-mediated
adhesion upon immunoreceptor activation. Skap1 is also
involved in T Cell Receptor (TCR)-induced RapL-Rap1
complex formation and LFA-1 activation. Skap1 has an
N-terminal coiled-coil conformation which is proposed to
be involved in homodimer formation, a central PH domain
and a C-terminal SH3 domain that associates with ADAP.
The Skap1 PH domain plays a role in controlling integrin
function via recruitment of ADAP-SKAP complexes to
integrins as well as in controlling the ability of ADAP
to interact with the CBM signalosome and regulate
NF-kappaB. SKAP1 is necessary for RapL binding to
membranes in a PH domain-dependent manner and the PI3K
pathway. Skap adaptor proteins couple receptors to
cytoskeletal rearrangements. Skap55/Skap1, Skap2, and
Skap-homology (Skap-hom) have an N-terminal coiled-coil
conformation, a central PH domain and a C-terminal SH3
domain. Their PH domains bind 3'-phosphoinositides as
well as directly affecting targets such as in Skap55
where it directly affecting integrin regulation by ADAP
and NF-kappaB activation or in Skap-hom where the
dimerization and PH domains comprise a
3'-phosphoinositide-gated molecular switch that controls
ruffle formation. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 106
Score = 29.5 bits (66), Expect = 0.20
Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 14/48 (29%)
Query: 75 GYLEKRTSDQ----ARWQTRWFVLYQNKVIAYCWSKGTFQSYASSIGK 118
GYLEKR+ D + WQ RW VL + F YA+ K
Sbjct: 5 GYLEKRSKDHGFFGSEWQKRWCVL----------TTRAFYYYANEKSK 42
>gnl|CDD|241269 cd01236, PH_RIP, Rho-Interacting Protein Pleckstrin homology (PH)
domain. RIP1-RhoGDI2 was obtained in a screen for
proteins that bind to wild-type RhoA. RIP2, RIP3, and
RIP4 were isolated from cDNA libraries with
constitutively active V14RhoA (containing the C190R
mutation). RIP2 represents a novel GDP/GTP exchange
factor (RhoGEF), while RIP3 (p116Rip) and RIP4 are
thought to be structural proteins. RhoGEF contains a
Dbl(DH)/PH region, a a zinc finger motif, a leucine-rich
domain, and a coiled-coil region. The last 2 domains are
thought to be involved in mediating protein-protein
interactions. RIP3 is a negative regulator of RhoA
signaling that inhibits, either directly or indirectly,
RhoA-stimulated actomyosin contractility. In plants RIP3
is localized at microtubules and interacts with the
kinesin-13 family member AtKinesin-13A, suggesting a
role for RIP3 in microtubule reorganization and a
possible function in Rho proteins of plants
(ROP)-regulated polar growth. It has a PH domain, two
proline-rich regions which are putative binding sites
for SH3 domains, and a COOH-terminal coiled-coil region
which overlaps with the RhoA-binding region. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 136
Score = 28.9 bits (65), Expect = 0.33
Identities = 10/19 (52%), Positives = 12/19 (63%)
Query: 84 QARWQTRWFVLYQNKVIAY 102
RWQ RWFVLY + + Y
Sbjct: 51 SKRWQRRWFVLYDDGELRY 69
>gnl|CDD|215766 pfam00169, PH, PH domain. PH stands for pleckstrin homology.
Length = 101
Score = 28.6 bits (64), Expect = 0.40
Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
Query: 73 LSGYLEKRTSDQAR-WQTRWFVLYQNKVIAYCWSKG 107
G+L K+ S + W+ R+FVL + V+ Y
Sbjct: 3 KEGWLLKKGSGGRKSWKKRYFVL-FDGVLLYYKDSK 37
>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP)
related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin
homology (PH) domain. Human ORP10 is involvedt in
intracellular transport or organelle positioning and is
proposed to function as a regulator of cellular lipid
metabolism. Human ORP11 localizes at the Golgi-late
endosome interface and is thought to form a dimer with
ORP9 functioning as an intracellular lipid sensor or
transporter. Both ORP10 and ORP11 contain a N-terminal
PH domain, a FFAT motif (two phenylalanines in an
acidic tract), and a C-terminal OSBP-related domain.
Oxysterol binding proteins are a multigene family that
is conserved in yeast, flies, worms, mammals and
plants. In general OSBPs and ORPs have been found to be
involved in the transport and metabolism of cholesterol
and related lipids in eukaryotes. They all contain a
C-terminal oxysterol binding domain, and most contain
an N-terminal PH domain. OSBP PH domains bind to
membrane phosphoinositides and thus likely play an
important role in intracellular targeting. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol
transport, cell cycle control, pollen development and
vessicle transport from Golgi recognize both PI lipids
and ARF proteins. PH domains have diverse functions,
but in general are involved in targeting proteins to
the appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 107
Score = 28.4 bits (64), Expect = 0.49
Identities = 12/22 (54%), Positives = 13/22 (59%)
Query: 73 LSGYLEKRTSDQARWQTRWFVL 94
L G L K T+ WQ RWFVL
Sbjct: 1 LEGQLSKYTNVVKGWQNRWFVL 22
>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding
protein related protein 2 Pleckstrin homology (PH)
domain. There are 2 types of ORPs found in
Cryptosporidium: CpORP1 and CpORP2. Cryptosporium
differs from other apicomplexans like Plasmodium,
Toxoplasma, and Eimeria which possess only a single
long-type ORP consisting of an N-terminal PH domain
followed by a C-terminal ligand binding (LB) domain.
CpORP2 is like this, but CpORP1 differs and has a
truncated N-terminus resulting in only having a LB
domain present. The exact functions of these proteins
are largely unknown though CpORP1 is thought to be
involved in lipid transport across the parasitophorous
vacuole membrane. Oxysterol binding proteins are a
multigene family that is conserved in yeast, flies,
worms, mammals and plants. In general OSBPs and ORPs
have been found to be involved in the transport and
metabolism of cholesterol and related lipids in
eukaryotes. They all contain a C-terminal oxysterol
binding domain, and most contain an N-terminal PH
domain. OSBP PH domains bind to membrane
phosphoinositides and thus likely play an important role
in intracellular targeting. They are members of the
oxysterol binding protein (OSBP) family which includes
OSBP, OSBP-related proteins (ORP), Goodpasture antigen
binding protein (GPBP), and Four phosphate adaptor
protein 1 (FAPP1). They have a wide range of purported
functions including sterol transport, cell cycle
control, pollen development and vessicle transport from
Golgi recognize both PI lipids and ARF proteins. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 88
Score = 28.1 bits (63), Expect = 0.49
Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQNKVIAYCWSKGT 108
GYL+K T+ W+ R+F+LY ++ Y KG
Sbjct: 3 GYLKKWTNIFNSWKPRYFILYPG-ILCYSKQKGG 35
>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2
Pleckstrin homology (PH) domain. Human FAPP1 (also
called PLEKHA3/Pleckstrin homology domain-containing,
family A member 3) regulates secretory transport from
the trans-Golgi network to the plasma membrane. It is
recruited through binding of PH domain to
phosphatidylinositol 4-phosphate (PtdIns(4)P) and a
small GTPase ADP-ribosylation factor 1 (ARF1). These two
binding sites have little overlap the FAPP1 PH domain to
associate with both ligands simultaneously and
independently. FAPP1 has a N-terminal PH domain followed
by a short proline-rich region. FAPP1 is a member of the
oxysterol binding protein (OSBP) family which includes
OSBP, OSBP-related proteins (ORP), and Goodpasture
antigen binding protein (GPBP). They have a wide range
of purported functions including sterol transport, cell
cycle control, pollen development and vessicle transport
from Golgi recognize both PI lipids and ARF proteins.
FAPP2 (also called PLEKHA8/Pleckstrin homology
domain-containing, family A member 8), a member of the
Glycolipid lipid transfer protein(GLTP) family has an
N-terminal PH domain that targets the TGN and C-terminal
GLTP domain. FAPP2 functions to traffic glucosylceramide
(GlcCer) which is made in the Golgi. It's interaction
with vesicle-associated membrane protein-associated
protein (VAP) could be a means of regulation. Some
FAPP2s share the FFAT-like motifs found in GLTP. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 100
Score = 28.1 bits (63), Expect = 0.50
Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSK 106
+ G L K T+ + WQ RWFVL + V++Y S+
Sbjct: 1 MEGVLYKWTNYLSGWQPRWFVL-DDGVLSYYKSQ 33
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol
3-beta-glucosyltransferase Pleckstrin homology (PH)
domain, repeat 1. ATG26 (also called
UGT51/UDP-glycosyltransferase 51), a member of the
glycosyltransferase 28 family, resulting in the
biosynthesis of sterol glucoside. ATG26 in decane
metabolism and autophagy. There are 32 known
autophagy-related (ATG) proteins, 17 are components of
the core autophagic machinery essential for all
autophagy-related pathways and 15 are the additional
components required only for certain pathways or
species. The core autophagic machinery includes 1) the
ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18,
and ATG27), 2) the phosphatidylinositol 3-kinase
complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3)
the ubiquitin-like protein system (ATG3, ATG4, ATG5,
ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known
about how the core machinery is adapted or modulated
with additional components to accommodate the
nonselective sequestration of bulk cytosol
(autophagosome formation) or selective sequestration of
specific cargos (Cvt vesicle, pexophagosome, or
bacteria-containing autophagosome formation). The
pexophagosome-specific additions include the
ATG30-ATG11-ATG17 receptor-adaptors complex, the
coiled-coil protein ATG25, and the sterol
glucosyltransferase ATG26. ATG26 is necessary for the
degradation of medium peroxisomes. It contains 2 GRAM
domains and a single PH domain. PH domains are only
found in eukaryotes. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. PH domains also have
diverse functions. They are often involved in targeting
proteins to the plasma membrane, but few display strong
specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 130
Score = 28.3 bits (64), Expect = 0.54
Identities = 11/25 (44%), Positives = 13/25 (52%)
Query: 70 DHSLSGYLEKRTSDQARWQTRWFVL 94
+ SGYL KR R+ WFVL
Sbjct: 28 EVVKSGYLSKRGKRTPRYNRYWFVL 52
>gnl|CDD|197369 cd09909, HIV-1-like_HR1-HR2, heptad repeat 1-heptad repeat 2
region (ectodomain) of the gp41 subunit of human
immunodeficiency virus (HIV-1), and related domains.
This domain family spans both heptad repeats of the
glycoprotein (gp)/transmembrane subunit of various
endogenous retroviruses (ERVs) and infectious
retroviruses, including human, simian, and feline
immunodeficiency viruses (HIV, SIV, and FIV), bovine
immunodeficiency-like virus (BIV), equine infectious
anaemia virus (EIAV), and Jaagsiekte sheep retrovirus
(JSRV), mouse mammary tumour virus (MMTV) and various
ERVs including sheep enJSRV-26, and human ERVs (HERVs):
HERV-K_c1q23.3 and HERV-K_c12q14.1. This domain belongs
to a larger superfamily containing the HR1-HR2 domain
of ERVs and infectious retroviruses, including Ebola
virus, and Rous sarcoma virus. Proteins in this family
lack the canonical CSK17-like immunosuppressive
sequence, and the intrasubunit disulfide bond-forming
CX6C motif found in linker region between HR1 and HR2
in the Ebola_RSV-like_HR1-HR2 family. N-terminal to the
HR1-HR2 region is a fusion peptide (FP), and C-terminal
is a membrane-spanning region (MSR). Viral infection
involves the formation of a trimer-of-hairpins
structure (three HR1 helices, buttressed by three HR2
helices lying in antiparallel orientation). In this
structure, the FP (inserted in the host cell membrane)
and MSR (inserted in the viral membrane) are in close
proximity. ERVs are likely to originate from ancient
germ-line infections by active retroviruses. Some
modern ERVs, those that integrated into the host genome
post-speciation, have a currently active exogenous
counterpart, such as JSRV. Some ERVs play specific
roles in the host, including placental development,
protection of the host from infection by related
pathogenic and exogenous retroviruses, and genome
plasticity. Included in this subgroup are ERVs from
domestic sheep that are related to JSRV, the agent of
transmissible lung cancer in sheep, for example
enJSRV-26 that retains an intact genome. These
endogenous JSRVs protect the sheep against JSRV
infection and are required for sheep placental
development. HERV-K_c12q14.1 is potentially a complete
envelope protein; however, it does not appear to be
fusogenic.
Length = 128
Score = 28.1 bits (63), Expect = 0.65
Identities = 10/56 (17%), Positives = 16/56 (28%), Gaps = 1/56 (1%)
Query: 36 SWHV-IGIVMLSPKLQRVVRINDHQLTNLSDRAKYDHSLSGYLEKRTSDQARWQTR 90
+ + + V L + +H L L K + LE R Q
Sbjct: 3 ARQLLVTRVQQQQSLIDAIEKLEHLLNLLYWVVKQLGARVQALEFRLKIQCHLNLW 58
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain
containing, family H (with MyTH4 domain) members 1 and 2
(PLEKHH1) PH domain, repeat 1. PLEKHH1 and PLEKHH2
(also called PLEKHH1L) are thought to function in
phospholipid binding and signal transduction. There are
3 Human PLEKHH genes: PLEKHH1, PLEKHH2, and PLEKHH3.
There are many isoforms, the longest of which contain a
FERM domain, a MyTH4 domain, two PH domains, a peroximal
domain, a vacuolar domain, and a coiled coil stretch.
The FERM domain has a cloverleaf tripart structure
(FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe,
B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the
FERM domain is part of the PH domain family. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 27.6 bits (62), Expect = 0.67
Identities = 11/29 (37%), Positives = 15/29 (51%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
+GYL K W+ RWFVL ++ Y
Sbjct: 2 AGYLTKLGGKVKTWKRRWFVLKNGELFYY 30
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding
proteins 1, 2, and 3 pleckstrin homology (PH) domain.
PEPP1 (also called PLEKHA4/PH domain-containing family
A member 4 and RHOXF1/Rhox homeobox family member 1),
and related homologs PEPP2 (also called PLEKHA5/PH
domain-containing family A member 5) and PEPP3 (also
called PLEKHA6/PH domain-containing family A member 6),
have PH domains that interact specifically with
PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3
specifically are: TAPP1 (tandem PH-domain-containing
protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd-
Ins(3,5)P2 (centaurin-beta2). All of these proteins
contain at least 5 of the 6 conserved amino acids that
make up the putative phosphatidylinositol 3,4,5-
trisphosphate-binding motif (PPBM) located at their
N-terminus. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 104
Score = 28.0 bits (63), Expect = 0.71
Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%)
Query: 72 SLSGYLEKRTSDQAR-WQTRWFVLYQN 97
SG+L K+ + W+ RWFVL N
Sbjct: 8 VFSGWLHKQGGSGLKNWKKRWFVLKDN 34
>gnl|CDD|241532 cd13381, PH_Skap-hom_Skap2, Src kinase-associated phosphoprotein
homolog and Skap 2 Pleckstrin homology (PH) domain.
Adaptor protein Skap-hom, a homolog of Skap55, which
interacts with actin and with ADAP (adhesion and
degranulation promoting adapter protein) undergoes
tyrosine phosphorylation in response to plating of bone
marrow-derived macrophages on fibronectin. Skap-hom has
an N-terminal coiled-coil conformation that is involved
in homodimer formation, a central PH domain and a
C-terminal SH3 domain that associates with ADAP. The
Skap-hom PH domain regulates intracellular targeting;
its interaction with the DM domain inhibits Skap-hom
actin-based ruffles in macrophages and its binding to
3'-phosphoinositides reverses this autoinhibition. The
Skap-hom PH domain binds PI[3,4]P2 and PI[3,4,5]P3, but
not to PI[3]P, PI[5]P, or PI[4,5]P2. Skap2 is a
downstream target of Heat shock transcription factor 4
(HSF4) and functions in the regulation of actin
reorganization during lens differentiation. It is
thought that SKAP2 anchors the complex of tyrosine
kinase adaptor protein 2 (NCK20/focal adhesion to
fibroblast growth factor receptors at the lamellipodium
in lens epithelial cells. Skap2 has an N-terminal
coiled-coil conformation which interacts with the SH2
domain of NCK2, a central PH domain and a C-terminal SH3
domain that associates with ADAP (adhesion and
degranulation promoting adapter protein)/FYB (the Fyn
binding protein). Skap2 PH domain binds to membrane
lipids. Skap adaptor proteins couple receptors to
cytoskeletal rearrangements. Src kinase-associated
phosphoprotein of 55 kDa (Skap55)/Src kinase-associated
phosphoprotein 1 (Skap1), Skap2, and Skap-hom have an
N-terminal coiled-coil conformation, a central PH domain
and a C-terminal SH3 domain. Their PH domains bind
3'-phosphoinositides as well as directly affecting
targets such as in Skap55 where it directly affecting
integrin regulation by ADAP and NF-kappaB activation or
in Skap-hom where the dimerization and PH domains
comprise a 3'-phosphoinositide-gated molecular switch
that controls ruffle formation. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 28.0 bits (62), Expect = 0.76
Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 6/33 (18%)
Query: 74 SGYLEKRTSDQA----RWQTRWFVLYQNKVIAY 102
+GYLEKR D + WQ RW L +K + Y
Sbjct: 4 AGYLEKRRKDHSFLGFEWQKRWCAL--SKTVFY 34
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain. Domain commonly found
in eukaryotic signalling proteins. The domain family
possesses multiple functions including the abilities to
bind inositol phosphates, and various proteins. PH
domains have been found to possess inserted domains
(such as in PLC gamma, syntrophins) and to be inserted
within other domains. Mutations in Brutons tyrosine
kinase (Btk) within its PH domain cause X-linked
agammaglobulinaemia (XLA) in patients. Point mutations
cluster into the positively charged end of the molecule
around the predicted binding site for
phosphatidylinositol lipids.
Length = 102
Score = 27.5 bits (61), Expect = 0.87
Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
Query: 73 LSGYLEKRTSDQ-ARWQTRWFVLYQNKVIAY 102
G+L K++ W+ R+FVL+ + ++ Y
Sbjct: 3 KEGWLYKKSGGGKKSWKKRYFVLFNSTLLYY 33
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 92
Score = 27.3 bits (60), Expect = 1.1
Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
Query: 73 LSGYLEKRTSDQAR-WQTRWFVLYQNKVIAY 102
G+L+KR + W+ RWFVL+ + ++ Y
Sbjct: 1 KEGWLKKRGGKGLKSWKKRWFVLFDDVLLYY 31
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
(AtPH1) PH domain. AtPH1 is expressed in all plant
tissue and is proposed to be the plant homolog of human
pleckstrin. Pleckstrin consists of two PH domains
separated by a linker region, while AtPH has a single
PH domain with a short N-terminal extension. AtPH1
binds PtdIns3P specifically and is thought to be an
adaptor molecule since it has no obvious catalytic
functions. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 117
Score = 27.3 bits (61), Expect = 1.3
Identities = 11/26 (42%), Positives = 16/26 (61%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKV 99
+G+L K+ W+ RWFVL Q K+
Sbjct: 10 AGWLTKQGGSIKTWRRRWFVLKQGKL 35
>gnl|CDD|182940 PRK11064, wecC, UDP-N-acetyl-D-mannosamine dehydrogenase;
Provisional.
Length = 415
Score = 27.6 bits (62), Expect = 1.5
Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 15/59 (25%)
Query: 2 ACERFSLWFFDARKSGIRQLRNSTNFEEIKRYIASWHVIGIVMLSPKLQRVVRINDHQL 60
AC F L F K I LR S E I IA WH G + VV N HQL
Sbjct: 324 AC--FGLAF----KPNIDDLRESPAME-IAELIAQWHS-GETL-------VVEPNIHQL 367
>gnl|CDD|214500 smart00065, GAF, Domain present in phytochromes and cGMP-specific
phosphodiesterases. Mutations within these domains in
PDE6B result in autosomal recessive inheritance of
retinitis pigmentosa.
Length = 149
Score = 27.0 bits (60), Expect = 1.9
Identities = 10/62 (16%), Positives = 20/62 (32%), Gaps = 6/62 (9%)
Query: 1 MACERFSLWFFDARKSG---IRQLRNSTNFEEIKRYIASWHVIGIVMLSPKLQRVVRIND 57
+ +R ++ D G + T R+ + G V + R + I D
Sbjct: 17 LGADRVLIYLVDENDRGELVLVAADGLTLPTLGIRFPLDEGLAGRVA---ETGRPLNIPD 73
Query: 58 HQ 59
+
Sbjct: 74 VE 75
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
OSBP-related protein 4 Pleckstrin homology (PH) domain.
Human OSBP is proposed to function is sterol-dependent
regulation of ERK dephosphorylation and sphingomyelin
synthesis as well as modulation of insulin signaling and
hepatic lipogenesis. It contains a N-terminal PH domain,
a FFAT motif (two phenylalanines in an acidic tract),
and a C-terminal OSBP-related domain. OSBPs and Osh1p PH
domains specifically localize to the Golgi apparatus in
a PtdIns4P-dependent manner. ORP4 is proposed to
function in Vimentin-dependent sterol transport and/or
signaling. Human ORP4 has 2 forms, a long (ORP4L) and a
short (ORP4S). ORP4L contains a N-terminal PH domain, a
FFAT motif (two phenylalanines in an acidic tract), and
a C-terminal OSBP-related domain. ORP4S is truncated and
contains only an OSBP-related domain. Oxysterol binding
proteins are a multigene family that is conserved in
yeast, flies, worms, mammals and plants. They all
contain a C-terminal oxysterol binding domain, and most
contain an N-terminal PH domain. OSBP PH domains bind to
membrane phosphoinositides and thus likely play an
important role in intracellular targeting. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol transport,
cell cycle control, pollen development and vessicle
transport from Golgi recognize both PI lipids and ARF
proteins. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 99
Score = 26.5 bits (59), Expect = 2.0
Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
G+L K T+ +Q RWFVL N +++Y
Sbjct: 1 FKGWLLKWTNYLKGYQRRWFVL-SNGLLSY 29
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH)
domain. The sesquipedalian family has 2 mammalian
members: Ses1 and Ses2, which are also callled 7 kDa
inositol polyphosphate phosphatase-interacting protein
1 and 2. They play a role in endocytic trafficking and
are required for receptor recycling from endosomes,
both to the trans-Golgi network and the plasma
membrane. Members of this family form homodimers and
heterodimers. Sesquipedalian interacts with inositol
polyphosphate 5-phosphatase OCRL-1 (INPP5F) also known
as Lowe oculocerebrorenal syndrome protein, a
phosphatase enzyme that is involved in actin
polymerization and is found in the trans-Golgi network
and INPP5B. Sesquipedalian contains a single PH domain.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from
other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 120
Score = 26.4 bits (59), Expect = 2.6
Identities = 11/23 (47%), Positives = 13/23 (56%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQN 97
GYL K+ +Q RWFVL N
Sbjct: 12 GYLWKKGERNTSYQKRWFVLKGN 34
>gnl|CDD|222881 PHA02566, alt, ADP-ribosyltransferase; Provisional.
Length = 684
Score = 27.0 bits (60), Expect = 2.8
Identities = 13/64 (20%), Positives = 22/64 (34%)
Query: 20 QLRNSTNFEEIKRYIASWHVIGIVMLSPKLQRVVRINDHQLTNLSDRAKYDHSLSGYLEK 79
+ +S + R IG V KL+ I T++ + K+ S+ LE
Sbjct: 292 RFESSDYELDYFRKFIFLRHIGEVDEKIKLKISEAIKQEDQTSIKNLEKFAASVDELLED 351
Query: 80 RTSD 83
Sbjct: 352 YKDI 355
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin
homology (PH) domain. SWAP-70 (also called
Differentially expressed in FDCP 6/DEF-6 or IRF4-binding
protein) functions in cellular signal transduction
pathways (in conjunction with Rac), regulates cell
motility through actin rearrangement, and contributes to
the transformation and invasion activity of mouse embryo
fibroblasts. Metazoan SWAP-70 is found in B lymphocytes,
mast cells, and in a variety of organs. Metazoan SWAP-70
contains an N-terminal EF-hand motif, a centrally
located PH domain, and a C-terminal coiled-coil domain.
The PH domain of Metazoan SWAP-70 contains a
phosphoinositide-binding site and a nuclear localization
signal (NLS), which localize SWAP-70 to the plasma
membrane and nucleus, respectively. The NLS is a
sequence of four Lys residues located at the N-terminus
of the C-terminal a-helix; this is a unique
characteristic of the Metazoan SWAP-70 PH domain. The
SWAP-70 PH domain binds PtdIns(3,4,5)P3 and
PtdIns(4,5)P2 embedded in lipid bilayer vesicles. There
are additional plant SWAP70 proteins, but these are not
included in this hierarchy. Rice SWAP70 (OsSWAP70)
exhibits GEF activity toward the its Rho GTPase, OsRac1,
and regulates chitin-induced production of reactive
oxygen species and defense gene expression in rice.
Arabidopsis SWAP70 (AtSWAP70) plays a role in both PAMP-
and effector-triggered immunity. Plant SWAP70 contains
both DH and PH domains, but their arrangement is the
reverse of that in typical DH-PH-type Rho GEFs, wherein
the DH domain is flanked by a C-terminal PH domain. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 110
Score = 26.1 bits (58), Expect = 3.0
Identities = 12/29 (41%), Positives = 15/29 (51%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQNKVIAYC 103
GYL K+ W+ RWFVL N + Y
Sbjct: 12 GYLWKKGHLLPTWRERWFVLKPNSLSYYK 40
>gnl|CDD|241481 cd13327, PH_PLEKHM3, Pleckstrin homology domain-containing family M
member 3 Pleckstrin homology domain. PLEKHM3 (also
called differentiation associated protein/DAPR)(also
called differentiation associated protein/DAPR) exists
as three alternatively spliced isoforms that participate
in metal ion binding. It contains 2 PH domains and 1
phorbol-ester/DAG-type zinc finger domain. PLEKHM3 is
found in Humans, canines, bovine, mouse, rat, chicken
and zebrafish. PH domains have diverse functions, but in
generally are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 88
Score = 26.0 bits (57), Expect = 3.1
Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 1/38 (2%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSKGTFQS 111
G LE+RT DQ+ W+ L + Y + G Q
Sbjct: 2 VGTLERRT-DQSNWKAFTCELSPTSLYLYAFQPGKLQC 38
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain. Yeast Boi
proteins Boi1 and Boi2 are functionally redundant and
important for cell growth with Boi mutants displaying
defects in bud formation and in the maintenance of cell
polarity.They appear to be linked to Rho-type GTPase,
Cdc42 and Rho3. Boi1 and Boi2 display two-hybrid
interactions with the GTP-bound ("active") form of
Cdc42, while Rho3 can suppress of the lethality caused
by deletion of Boi1 and Boi2. These findings suggest
that Boi1 and Boi2 are targets of Cdc42 that promote
cell growth in a manner that is regulated by Rho3. Boi
proteins contain a N-terminal SH3 domain, followed by a
SAM (sterile alpha motif) domain, a proline-rich region,
which mediates binding to the second SH3 domain of Bem1,
and C-terminal PH domain. The PH domain is essential for
its function in cell growth and is important for
localization to the bud, while the SH3 domain is needed
for localization to the neck. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 95
Score = 25.8 bits (57), Expect = 3.2
Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 11/42 (26%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSKGTFQSYASS 115
SG+++KR W+TR+FVL KGT Y S
Sbjct: 2 SGWMKKRGERYGTWKTRYFVL-----------KGTRLYYLKS 32
>gnl|CDD|220395 pfam09778, Guanylate_cyc_2, Guanylylate cyclase. Members of this
family of proteins catalyze the conversion of guanosine
triphosphate (GTP) to 3',5'-cyclic guanosine
monophosphate (cGMP) and pyrophosphate.
Length = 212
Score = 26.6 bits (59), Expect = 3.4
Identities = 11/36 (30%), Positives = 18/36 (50%)
Query: 5 RFSLWFFDARKSGIRQLRNSTNFEEIKRYIASWHVI 40
R + F A +GI S + +EI+ ++ S HV
Sbjct: 91 RVNELFQKAESAGIDVECRSVSIQEIQEHLLSGHVA 126
>gnl|CDD|182710 PRK10765, PRK10765, nitroreductase A; Provisional.
Length = 240
Score = 26.5 bits (59), Expect = 3.4
Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%)
Query: 45 LSPKLQR--VVRINDHQLTNLSDRAKYDHSLSGYLEKRTSDQARWQTRW 91
L P+L +V N +Q + A+YD L+ Y R+S+ R T W
Sbjct: 166 LKPRLPASLLVHENQYQPLDKDLLAQYDEQLAEYYLTRSSNN-RQDT-W 212
>gnl|CDD|219174 pfam06780, Erp_C, Erp protein C-terminus. This family represents
the C-terminus of bacterial Erp proteins that seem to be
specific to Borrelia burgdorferi (a causative agent of
Lyme disease). Borrelia Erp proteins are particularly
heterogeneous, which might enable them to interact with
a wide variety of host components.
Length = 141
Score = 26.2 bits (58), Expect = 3.4
Identities = 8/15 (53%), Positives = 10/15 (66%)
Query: 21 LRNSTNFEEIKRYIA 35
L + NFEEIK Y+
Sbjct: 125 LEDKDNFEEIKGYVK 139
>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
homology (PH) domain. The GPBP (also called Collagen
type IV alpha-3-binding protein/hCERT; START
domain-containing protein 11/StARD11; StAR-related lipid
transfer protein 11) is a kinase that phosphorylates an
N-terminal region of the alpha 3 chain of type IV
collagen, which is commonly known as the goodpasture
antigen. Its splice variant the ceramide transporter
(CERT) mediates the cytosolic transport of ceramide.
There have been additional splice variants identified,
but all of them function as ceramide transport proteins.
GPBP and CERT both contain an N-terminal PH domain,
followed by a serine rich domain, and a C-terminal START
domain. However, GPBP has an additional serine rich
domain just upstream of its START domain. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol transport,
cell cycle control, pollen development and vessicle
transport from Golgi recognize both PI lipids and ARF
proteins. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 100
Score = 25.7 bits (57), Expect = 3.5
Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
L G L K T+ WQ R+FVL ++ ++Y
Sbjct: 1 LRGVLSKWTNYIHGWQDRYFVL-KDGTLSY 29
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin
homology (PH) domain, repeat 2. ADAP (also called
centaurin alpha) is a phophatidlyinositide binding
protein consisting of an N-terminal ArfGAP domain and
two PH domains. In response to growth factor
activation, PI3K phosphorylates phosphatidylinositol
4,5-bisphosphate to phosphatidylinositol
3,4,5-trisphosphate. Centaurin alpha 1 is recruited to
the plasma membrane following growth factor stimulation
by specific binding of its PH domain to
phosphatidylinositol 3,4,5-trisphosphate. Centaurin
alpha 2 is constitutively bound to the plasma membrane
since it binds phosphatidylinositol 4,5-bisphosphate
and phosphatidylinositol 3,4,5-trisphosphate with equal
affinity. This cd contains the second PH domain repeat.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from
other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 105
Score = 25.6 bits (57), Expect = 3.7
Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 5/28 (17%)
Query: 75 GYLEK---RTSDQARWQTRWFVLYQNKV 99
GYLEK + +D ++ RWF L ++
Sbjct: 6 GYLEKTGPKQTD--GFRKRWFTLDDRRL 31
>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein
9 Pleckstrin homology (PH) domain. Human ORP9 is
proposed to function in regulation of Akt
phosphorylation. ORP9 has 2 forms, a long (ORP9L) and a
short (ORP9S). ORP9L contains an N-terminal PH domain,
a FFAT motif (two phenylalanines in an acidic tract),
and a C-terminal OSBP-related domain. ORP1S is
truncated and contains a FFAT motif and an OSBP-related
domain. Oxysterol binding proteins are a multigene
family that is conserved in yeast, flies, worms,
mammals and plants. In general OSBPs and ORPs have been
found to be involved in the transport and metabolism of
cholesterol and related lipids in eukaryotes. They all
contain a C-terminal oxysterol binding domain, and most
contain an N-terminal PH domain. OSBP PH domains bind
to membrane phosphoinositides and thus likely play an
important role in intracellular targeting. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol
transport, cell cycle control, pollen development and
vessicle transport from Golgi recognize both PI lipids
and ARF proteins. PH domains have diverse functions,
but in general are involved in targeting proteins to
the appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 102
Score = 25.9 bits (57), Expect = 4.1
Identities = 12/25 (48%), Positives = 14/25 (56%)
Query: 73 LSGYLEKRTSDQARWQTRWFVLYQN 97
+ G L K T+ WQ RWFVL N
Sbjct: 1 MEGPLSKWTNVMKGWQYRWFVLDDN 25
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin
homology (PH) domain. RhoGap24 (also called ARHGAP24,
p73RhoGAp, and Filamin-A-associated RhoGAP) like other
RhoGAPs are involved in cell polarity, cell morphology
and cytoskeletal organization. They act as GTPase
activators for the Rac-type GTPases by converting them
to an inactive GDP-bound state and control actin
remodeling by inactivating Rac downstream of Rho leading
to suppress leading edge protrusion and promotes cell
retraction to achieve cellular polarity and are able to
suppress RAC1 and CDC42 activity in vitro.
Overexpression of these proteins induces cell rounding
with partial or complete disruption of actin stress
fibers and formation of membrane ruffles, lamellipodia,
and filopodia. Members here contain an N-terminal PH
domain followed by a RhoGAP domain and either a BAR or
TATA Binding Protein (TBP) Associated Factor 4 (TAF4)
domain. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 114
Score = 25.7 bits (56), Expect = 4.1
Identities = 10/28 (35%), Positives = 16/28 (57%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQNKVIAY 102
G+L K+ W TRWFVL +++ +
Sbjct: 7 GWLRKQGGFVKTWHTRWFVLKGDQLYYF 34
>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related
protein Pleckstrin homology (PH) domain. Plant ORPs
contain a N-terminal PH domain and a C-terminal
OSBP-related domain. Not much is known about its
specific function in plants to date. Members here
include: Arabidopsis, spruce, and petunia. Oxysterol
binding proteins are a multigene family that is
conserved in yeast, flies, worms, mammals and plants. In
general OSBPs and ORPs have been found to be involved in
the transport and metabolism of cholesterol and related
lipids in eukaryotes. They all contain a C-terminal
oxysterol binding domain, and most contain an N-terminal
PH domain. OSBP PH domains bind to membrane
phosphoinositides and thus likely play an important role
in intracellular targeting. They are members of the
oxysterol binding protein (OSBP) family which includes
OSBP, OSBP-related proteins (ORP), Goodpasture antigen
binding protein (GPBP), and Four phosphate adaptor
protein 1 (FAPP1). They have a wide range of purported
functions including sterol transport, cell cycle
control, pollen development and vessicle transport from
Golgi recognize both PI lipids and ARF proteins. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 100
Score = 25.5 bits (56), Expect = 4.4
Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
Query: 75 GYLEKRTSDQARWQTRWFVLYQNKVIAY 102
G L K + W++RWFVL Q+ V++Y
Sbjct: 3 GILYKWVNYGKGWRSRWFVL-QDGVLSY 29
>gnl|CDD|237943 PRK15318, PRK15318, intimin-like protein SinH; Provisional.
Length = 730
Score = 26.5 bits (58), Expect = 4.7
Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 1/37 (2%)
Query: 5 RFSLWFFDARKSGIRQLRNSTNFEEIKRYIASWHVIG 41
RF LW D K G+ Q EE+ +Y W G
Sbjct: 644 RFVLWR-DKNKDGVFQQSEKLTEEEMAQYDYKWEFTG 679
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human
MTMR5) Pleckstrin Homology (PH) domain. Sbf1 is a
myotubularin-related pseudo-phosphatase. Both Sbf1 and
myotubularin interact with the SET domains of Hrx and
other epigenetic regulatory proteins, but Sbf1 lacks
phosphatase activity due to several amino acid changes
in its structurally preserved catalytic pocket. It
contains pleckstrin (PH), GEF, and myotubularin
homology domains that are thought to be responsible for
signaling and growth control. Sbf1 functions as an
inhibitor of cellular growth. The N-terminal GEF
homology domain serves to inhibit the transforming
effects of Sbf1. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 25.3 bits (56), Expect = 5.0
Identities = 12/29 (41%), Positives = 15/29 (51%)
Query: 70 DHSLSGYLEKRTSDQARWQTRWFVLYQNK 98
+ GYL KR + W+ RWFVL K
Sbjct: 2 SRTCEGYLYKRGALLKGWKQRWFVLDLTK 30
>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
protein) 1 Pleckstrin homology (PH) domain. RASA1
(also called RasGap1 or p120) is a member of the RasGAP
family of GTPase-activating proteins. RASA1 contains
N-terminal SH2-SH3-SH2 domains, followed by two C2
domains, a PH domain, a RasGAP domain, and a BTK
domain. Splice variants lack the N-terminal domains. It
is a cytosolic vertebrate protein that acts as a
suppressor of RAS via its C-terminal GAP domain
function, enhancing the weak intrinsic GTPase activity
of RAS proteins resulting in the inactive GDP-bound
form of RAS, allowing control of cellular proliferation
and differentiation. Additionally, it is involved in
mitogenic signal transmission towards downstream
interacting partners through its N-terminal SH2-SH3-SH2
domains. RASA1 interacts with a number of proteins
including: G3BP1, SOCS3, ANXA6, Huntingtin, KHDRBS1,
Src, EPHB3, EPH receptor B2, Insulin-like growth factor
1 receptor, PTK2B, DOK1, PDGFRB, HCK, Caveolin 2,
DNAJA3, HRAS, GNB2L1 and NCK1. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold,
which is electrostatically polarized. Less than 10% of
PH domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 103
Score = 25.4 bits (56), Expect = 5.2
Identities = 8/25 (32%), Positives = 14/25 (56%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNK 98
GYL K++ +W+ +FVL +
Sbjct: 6 KGYLLKKSGKNKKWKNLYFVLEGAE 30
>gnl|CDD|219694 pfam08008, Viral_cys_rich, Viral cysteine rich. Members of this
family are polydna viral proteins that contain a
cysteine rich motif. Some members of this family have
multiple copies of this domain.
Length = 86
Score = 25.0 bits (55), Expect = 6.0
Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 2/20 (10%)
Query: 18 IRQLRNSTNFEEIKR-YIAS 36
++QL N TNFEE+ Y
Sbjct: 62 VKQL-NDTNFEELSNQYWKD 80
>gnl|CDD|234202 TIGR03417, chol_sulfatase, choline-sulfatase.
Length = 500
Score = 25.8 bits (57), Expect = 7.7
Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 16/49 (32%)
Query: 58 HQLTNLSDRAKYDHSLSGYLEKRTSDQARWQT-------------RWFV 93
H+LTNL+D + +L+ + + ARW RW V
Sbjct: 414 HELTNLADDPAHADTLAAFRAEA---AARWDLPAFDAQVRASQRRRWVV 459
>gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin
domain-containing protein 1 and related proteins
Pleckstrin Homology (PH) domain, repeat 2. Members
here include FARP1 (also called Chondrocyte-derived
ezrin-like protein; PH domain-containing family C
member 2), FARP2 (also called FIR/FERM domain including
RhoGEF; FGD1-related Cdc42-GEF/FRG), and FARP6 (also
called Zinc finger FYVE domain-containing protein 24).
They are members of the Dbl family guanine nucleotide
exchange factors (GEFs) which are upstream positive
regulators of Rho GTPases. Little is known about FARP1
and FARP6, though FARP1 has increased expression in
differentiated chondrocytes. FARP2 is thought to
regulate neurite remodeling by mediating the signaling
pathways from membrane proteins to Rac. It is found in
brain, lung, and testis, as well as embryonic
hippocampal and cortical neurons. FARP1 and FARP2 are
composed of a N-terminal FERM domain, a proline-rich
(PR) domain, Dbl-homology (DH), and two C-terminal PH
domains. FARP6 is composed of Dbl-homology (DH), and
two C-terminal PH domains separated by a FYVE domain.
This hierarchy contains the second PH repeat. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from
other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 113
Score = 25.0 bits (55), Expect = 8.2
Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%)
Query: 58 HQLTNLSDR---AKYDHSLSGYLEKRTSDQARWQTRWFVL 94
H+ T++S A ++ +SGYL ++ + WQ W V
Sbjct: 2 HRNTSVSMNDHLAAVENQMSGYLLRKFKNSNGWQKLWVVF 41
>gnl|CDD|234426 TIGR03975, rSAM_ocin_1, bacteriocin maturation radical SAM protein
1. Models TIGR03793 and TIGR03798 describe bacteriocin
precursor families to occur often in large paralogous
families and are subject to various modifications,
including by LanM family lantibiotic synthases and by
cyclodehydratases. This model represents a radical SAM
protein family that regularly occurs in the context of
these bacteriocins, and may occur where other familiar
peptide modification enzymes are absent [Cellular
processes, Toxin production and resistance].
Length = 606
Score = 25.4 bits (56), Expect = 8.7
Identities = 8/19 (42%), Positives = 12/19 (63%)
Query: 4 ERFSLWFFDARKSGIRQLR 22
+RFS +F + G+R LR
Sbjct: 445 DRFSPYFNRPERFGLRNLR 463
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional.
Length = 394
Score = 25.5 bits (57), Expect = 9.1
Identities = 6/16 (37%), Positives = 9/16 (56%)
Query: 91 WFVLYQNKVIAYCWSK 106
F Y N ++ Y +SK
Sbjct: 229 IFKYYDNSIVVYSFSK 244
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.324 0.133 0.424
Gapped
Lambda K H
0.267 0.0618 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,022,028
Number of extensions: 504436
Number of successful extensions: 626
Number of sequences better than 10.0: 1
Number of HSP's gapped: 622
Number of HSP's successfully gapped: 67
Length of query: 118
Length of database: 10,937,602
Length adjustment: 81
Effective length of query: 37
Effective length of database: 7,344,928
Effective search space: 271762336
Effective search space used: 271762336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.4 bits)