Diaphorina citri psyllid: psy13578


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MHMNMCRRLMADRKHHHRRSKRLNKDGSKQSHVTFPGIQQNGSAKQFTSGVILLTAIVNQFRIYKLTRVDKFVMCYGGLRGAVAFALVLLIDPR
ccccHHHHHHHccccHHHcccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHccccc
*********************************TFPGIQQNGSAKQFTSGVILLTAIVNQFRIYKLTRVDKFVMCYGGLRGAVAFALVLLID**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMNMCRRLMADRKHHHRRSKRLNKDGSKQSHVTFPGIQQNGSAKQFTSGVILLTAIVNQFRIYKLTRVDKFVMCYGGLRGAVAFALVLLIDPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 5 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ9Z0X2
Sodium/hydrogen exchanger 5 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ14940

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010447 [BP]response to acidityprobableGO:0009268, GO:0050896, GO:0008150, GO:0009628
GO:0031526 [CC]brush border membraneprobableGO:0016020, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0005575, GO:0005903, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0015385 [MF]sodium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015081, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015078, GO:0022804
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0051453 [BP]regulation of intracellular pHprobableGO:0019725, GO:0044699, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0030641
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0048306 [MF]calcium-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0001101 [BP]response to acidprobableGO:0042221, GO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KBV, chain A
Confidence level:confident
Coverage over the Query: 69-94
View the alignment between query and template
View the model in PyMOL