Diaphorina citri psyllid: psy1357


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MQAINNDTQFLANQHVMDYSLLLGIDDTNMELVVGMIDYIRTFTWDKKIETMVKKSGLLGGQGKLPTIVSPDEYRKRFQSAMNRYFLGVPDRWSGQLGSKGGLLFHITEGPVH
cHHHHHHHHHHHHccccccEEEEEECccccEEEEEEEEEEEEccHHHHHHHHHHHHccccccccccEEEcHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
MQAINNDTQFLANQHVMDYSLLLGIDDTNMELVVGMIDYIRTFTWDKKIETMVKKSGLLGGQGKLPTIVSPDEYRKRFQSAMNRYFLGVPDRWSGQLGSKGGLLFHIT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAINNDTQFLANQHVMDYSLLLGIDDTNMELVVGMIDYIRTFTWDKKIETMVKKSGLLGGQGKLPTIVSPDEYRKRFQSAMNRYFLGVPDRWSGQLGSKGGLLFHITEGPVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-phosphatidylinositol 3-phosphate 5-kinase The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes.confidentQ9Y2I7
1-phosphatidylinositol 3-phosphate 5-kinase Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate.confidentB0G126
1-phosphatidylinositol 3-phosphate 5-kinase fab1 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) (By similarity). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. The product of the reaction it catalyzes functions as an important regulator of vacuole homeostasis perhaps by controlling membrane flux to and/or from the vacuole (By similarity). Required for survival under conditions of nitrogen starvation. May have a role in the secretion of pheromone peptides.confidentO59722

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016308 [MF]1-phosphatidylinositol-4-phosphate 5-kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0016307, GO:0003824, GO:0016740, GO:0003674
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0046854 [BP]phosphatidylinositol phosphorylationprobableGO:0044238, GO:0006644, GO:0006650, GO:0071704, GO:0016310, GO:0009987, GO:0044710, GO:0044237, GO:0046834, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006873 [BP]cellular ion homeostasisprobableGO:0019725, GO:0050801, GO:0009987, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0007033 [BP]vacuole organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0016197 [BP]endosomal transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0032593 [CC]insulin-responsive compartmentprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GK9, chain A
Confidence level:very confident
Coverage over the Query: 1-28
View the alignment between query and template
View the model in PyMOL