Diaphorina citri psyllid: psy13590


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MTPRLNQIFPESCLLIFVGVVIGVLLFLTTNIHIHPLTPDTFFLYMLPPIILDAGYFMPNRLFFDHLGTILLFAVIGTIFNTLSIACIEL
ccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
***RLNQIFPESCLLIFVGVVIGVLLFLTTNIHIHPLTPDTFFLYMLPPIILDAGYFMPNRLFFDHLGTILLFAVIGTIFNTLSIACIEL
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPRLNQIFPESCLLIFVGVVIGVLLFLTTNIHIHPLTPDTFFLYMLPPIILDAGYFMPNRLFFDHLGTILLFAVIGTIFNTLSIACIEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 2 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption.confidentP48763
Sodium/hydrogen exchanger 2 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption.confidentP50482
Sodium/hydrogen exchanger 2 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption.confidentQ9UBY0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0010447 [BP]response to acidityprobableGO:0009268, GO:0050896, GO:0008150, GO:0009628
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015385 [MF]sodium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015081, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015078, GO:0022804
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0015386 [MF]potassium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015078, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015079, GO:0022821, GO:0022804
GO:0042539 [BP]hypotonic salinity responseprobableGO:0009628, GO:0050896, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0009651
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055038 [CC]recycling endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0030641 [BP]regulation of cellular pHprobableGO:0019725, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y4E, chain A
Confidence level:very confident
Coverage over the Query: 37-61
View the alignment between query and template
View the model in PyMOL