Diaphorina citri psyllid: psy13603

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MVMKLINLRGRERLLLSVLPEHVAVQMRQDLGENFDSLFKKIYMSRHENLLISGKKISRRGAVSLENIICTNVILLVSANILGQMCYHMSEKEQRTAFLETRQCLEMRLVIEEQSAEQRFDKGNYNCGHIVPK
ccccccHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
*VMKLINLRGRERLLLSVLPEHVAVQMRQDLGENFDSLFKKIYMSRHENLLISGKKISRRGAVSLENIICTNVILLVSANILGQMCYHMSEKEQRTAFLETRQCLEMRLVIE************YNCGHIVP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMKLINLRGRERLLLSVLPEHVAVQMRQDLGENFDSLFKKIYMSRHENLLISGKKISRRGAVSLENIICTNVILLVSANILGQMCYHMSEKEQRTAFLETRQCLEMRLVIEEQSAEQRFDKGNYNCGHIVPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0004016 [MF]adenylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AZS, chain A
Confidence level:confident
Coverage over the Query: 36-133
View the alignment between query and template
View the model in PyMOL
Template: 1Y10, chain A
Confidence level:confident
Coverage over the Query: 5-129
View the alignment between query and template
View the model in PyMOL