Diaphorina citri psyllid: psy13609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
FEKYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIEQDSVDGLTHYTEKVLDDLGLTYNDDDILIVQRVCHLLSLRATLLVSICTAVLVRRIDRDDITIAVDRIRQMCGRQLFNSEVFYYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIE
cccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccCEccccccccccccccccccccccc
FEKYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIEQDSVDGLTHYTEKVLDDLGLTYNDDDILIVQRVCHLLSLRATLLVSICTAVLVRRIDRDDITIAVDRIRQMCGRQLFNSEVFYYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FEKYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIEQDSVDGLTHYTEKVLDDLGLTYNDDDILIVQRVCHLLSLRATLLVSICTAVLVRRIDRDDITIAVDRIRQMCGRQLFNSEVFYYISGKYLGELVRVVLCRLVRDGLLFNGVSSEDLVTPNAFRTSFVSLIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032559 [MF]adenyl ribonucleotide bindingprobableGO:0030554, GO:0097159, GO:0000166, GO:0036094, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:1901363, GO:1901265, GO:0005488
GO:0032550 [MF]purine ribonucleoside bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:1901363, GO:0001883, GO:0001882
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0005536 [MF]glucose bindingprobableGO:0005488, GO:0003674, GO:0048029, GO:0030246

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CZA, chain N
Confidence level:very confident
Coverage over the Query: 1-162
View the alignment between query and template
View the model in PyMOL
Template: 3F9M, chain A
Confidence level:very confident
Coverage over the Query: 110-182
View the alignment between query and template
View the model in PyMOL