Diaphorina citri psyllid: psy13610


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MARKDIFPDENTPDLIFDGLKFKNLPIMNIRVTKNNTILSLSDAKGVVKLLRSCGMEGFKNARKGTNIAAQAAGITIGKKALEIGVSSVRINVRGLGPGRLKALEIGVSSVRINVRGLGPGRL
cccccccccccccccCCccCEECcccEEEEEcccccEEEEEEcccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHccccEEEECcccccc
*************DLIFDGLKFKNLPIMNIRVTKNNTILSLSDAKGVVKLLRSCGMEGFKNARKGTNIAAQAAGITIGKKALEIGVSSVRINVRGLGPGRLKALEIGVSSVRINVRGLGPG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARKDIFPDENTPDLIFDGLKFKNLPIMNIRVTKNNTILSLSDAKGVVKLLRSCGMEGFKNARKGTNIAAQAAGITIGKKALEIGVSSVRINVRGLGPGRLKALEIGVSSVRINVRGLGPGRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.confidentQ2FW31
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.confidentQ48D59
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.confidentA9IHR9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0070181 [MF]SSU rRNA bindingprobableGO:0097159, GO:0019843, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain K
Confidence level:very confident
Coverage over the Query: 23-114
View the alignment between query and template
View the model in PyMOL