Diaphorina citri psyllid: psy13658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MSNHAVVVWEWLNRNRRWRPFTPEVTQLIERAHSKNLTSVILSDADPNLQNYFINLHTLQQCSEIDGAITNVRRSFYPPDSPAGKGARWEWEGDVHGEWHAYDMQAQCLIEYSWAKGDQTIDISKTHLGFPYILNFCNLTQVRNTTGNVRNIRRTQQAPYPLIKLSTNQMAEIQGQMSASQGAVTMTTPGKKCKHTTSSNITRTLRNIFHGPVHPMSPVYEDIWRAYG
cccccEEEEEEEcccccEECccHHHHHHHHHHHcccccCEEEECcccccccEEEEccccccccccccCEEEccccccccccccccccEEEEECcccccCEEccHHHHHHHHHHHHcccccEECccccccccEEEEcccCEEECcccccEEEEEECcccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcc
***HAVVVWEWLNRNRRWRPFTPEVTQLIERAHSKNLTSVILSDADPNLQNYFINLHTLQQCSEIDGAITNVRRSFYPP**PAGKGARWEWEGDVHGEWHAYDMQAQCLIEYSWAKGDQTIDISKTHLGFPYILNFCNLTQVRNTTGNVRNIRRTQQAPYPLIKL***********************************************VHPMSPVYEDIWRAY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNHAVVVWEWLNRNRRWRPFTPEVTQLIERAHSKNLTSVILSDADPNLQNYFINLHTLQQCSEIDGAITNVRRSFYPPDSPAGKGARWEWEGDVHGEWHAYDMQAQCLIEYSWAKGDQTIDISKTHLGFPYILNFCNLTQVRNTTGNVRNIRRTQQAPYPLIKLSTNQMAEIQGQMSASQGAVTMTTPGKKCKHTTSSNITRTLRNIFHGPVHPMSPVYEDIWRAYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein deltex Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it may also act as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch. May function as an ubiquitin ligase protein in the Notch pathway.confidentQ23985

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A90, chain A
Confidence level:very confident
Coverage over the Query: 3-164
View the alignment between query and template
View the model in PyMOL