BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13685
         (72 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase
           (Target Psi-012003) From Sinorhizobium Meliloti 1021
 pdb|4EJM|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase
           (Target Psi-012003) From Sinorhizobium Meliloti 1021
           Bound To Nadp
          Length = 370

 Score = 25.8 bits (55), Expect = 6.5,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 13  DPIAG-YIDNLYGPTGLVTGVQAGIIRCISNARHIK 47
           DP AG  ++ + GP GLV G    +I C   A  +K
Sbjct: 233 DPSAGDVVEAIAGPVGLVPGGVDVVIECAGVAETVK 268


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.138    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,400,530
Number of Sequences: 62578
Number of extensions: 77147
Number of successful extensions: 112
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 112
Number of HSP's gapped (non-prelim): 1
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)