Query         psy13712
Match_columns 63
No_of_seqs    37 out of 39
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 18:33:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13712.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13712hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1654 BirA Biotin operon rep  47.8     2.9 6.3E-05   26.0  -1.4   12   40-51     30-41  (79)
  2 PF09776 Mitoc_L55:  Mitochondr  44.7      12 0.00026   25.2   1.0   28   13-40     52-80  (116)
  3 PF07668 MpPF1:  M penetrans pa  33.5      22 0.00048   27.4   1.1   33    6-38    135-175 (315)
  4 COG3861 Uncharacterized protei  30.1      30 0.00065   25.3   1.3   20   19-38    125-146 (195)
  5 PF10512 Borealin:  Cell divisi  28.8      32 0.00069   22.7   1.1   17   14-30     64-80  (116)
  6 PF06007 PhnJ:  Phosphonate met  27.4      54  0.0012   25.1   2.2   42    3-45     33-87  (277)
  7 PF07026 DUF1317:  Protein of u  23.3      32 0.00069   21.0   0.3   28   16-43     11-47  (60)
  8 cd06472 ACD_ScHsp26_like Alpha  22.7      61  0.0013   19.1   1.5   23    9-32     17-39  (92)
  9 KOG3908|consensus               21.8      18 0.00039   28.8  -1.3   22   42-63    228-249 (396)
 10 PF15493 YrpD:  Domain of unkno  20.5 1.3E+02  0.0028   22.3   3.0   44    9-52     93-160 (208)

No 1  
>COG1654 BirA Biotin operon repressor [Transcription]
Probab=47.77  E-value=2.9  Score=25.96  Aligned_cols=12  Identities=25%  Similarity=0.955  Sum_probs=10.2

Q ss_pred             hccccccceeec
Q psy13712         40 EVNKTGIWKQVN   51 (63)
Q Consensus        40 EM~KT~iWK~l~   51 (63)
                      .|+.|+|||+|.
T Consensus        30 giSRtaVwK~Iq   41 (79)
T COG1654          30 GISRTAVWKHIQ   41 (79)
T ss_pred             CccHHHHHHHHH
Confidence            578999999975


No 2  
>PF09776 Mitoc_L55:  Mitochondrial ribosomal protein L55;  InterPro: IPR018615  Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. 
Probab=44.72  E-value=12  Score=25.16  Aligned_cols=28  Identities=29%  Similarity=0.470  Sum_probs=21.3

Q ss_pred             CCCCeeeeecCC-CCeeeecccccccchh
Q psy13712         13 PSYGNLQIPLAN-GNIMKIPVTSINISEE   40 (63)
Q Consensus        13 ~~e~~vqiPle~-g~vl~IPl~~INISDE   40 (63)
                      +.+.+++|.+.+ ..+|++||.--.+|+|
T Consensus        52 pDGSTI~Iry~EPR~ii~mPlDl~~LSee   80 (116)
T PF09776_consen   52 PDGSTINIRYHEPRRIIKMPLDLDTLSEE   80 (116)
T ss_pred             cCCCEEEEeccChHHHhccccCcccCCHH
Confidence            567889999966 8889999955555544


No 3  
>PF07668 MpPF1:  M penetrans paralogue family 1;  InterPro: IPR011653 This group of paralogous proteins identified in Mycoplasma penetrans includes homologues of lipoprotein p35 [].; GO: 0016020 membrane
Probab=33.48  E-value=22  Score=27.38  Aligned_cols=33  Identities=21%  Similarity=0.369  Sum_probs=24.1

Q ss_pred             CCCCCCCCCCCeeeeecCCC--------Ceeeecccccccc
Q psy13712          6 SSSNPGFPSYGNLQIPLANG--------NIMKIPVTSINIS   38 (63)
Q Consensus         6 ~~~~~~~~~e~~vqiPle~g--------~vl~IPl~~INIS   38 (63)
                      -..++||-.+.-||+-...-        .-||||++.||+.
T Consensus       135 v~N~lG~t~~DLLHVNV~~t~~~~~~~n~DLqIPvSdiNL~  175 (315)
T PF07668_consen  135 VKNKLGLTNGDLLHVNVTATKSSSSTTNYDLQIPVSDINLK  175 (315)
T ss_pred             EecccCccCCCEEEEEEEEecCCCCceeeeEeeecccceee
Confidence            34678998777788876432        2489999888877


No 4  
>COG3861 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.12  E-value=30  Score=25.29  Aligned_cols=20  Identities=35%  Similarity=0.843  Sum_probs=16.4

Q ss_pred             eeecCCCCeeeecc--cccccc
Q psy13712         19 QIPLANGNIMKIPV--TSINIS   38 (63)
Q Consensus        19 qiPle~g~vl~IPl--~~INIS   38 (63)
                      -.|++.|-++.|||  +.+||+
T Consensus       125 ~~~~~~~e~~rIpl~EE~~~v~  146 (195)
T COG3861         125 GAPLEAGEVIRIPLSEERVNVS  146 (195)
T ss_pred             CCcccCCcEEEeeccccccccc
Confidence            46888999999999  667776


No 5  
>PF10512 Borealin:  Cell division cycle-associated protein 8 ;  InterPro: IPR018867  The chromosomal passenger complex of Aurora B kinase, INCENP, and Survivin has essential regulatory roles at centromeres and the central spindle in mitosis. Cell division cycle-associated protein 8, also known as Borealin, is also a member of the complex. Approximately half of Aurora B in mitotic cells is complexed with INCENP, Borealin, and Survivin. Depletion of Borealin by RNA interference delays mitotic progression and results in kinetochore-spindle mis-attachments and an increase in bipolar spindles associated with ectopic asters []. ; PDB: 2KDD_A.
Probab=28.78  E-value=32  Score=22.65  Aligned_cols=17  Identities=35%  Similarity=0.724  Sum_probs=7.6

Q ss_pred             CCCeeeeecCCCCeeee
Q psy13712         14 SYGNLQIPLANGNIMKI   30 (63)
Q Consensus        14 ~e~~vqiPle~g~vl~I   30 (63)
                      ....|+||+.+|..+++
T Consensus        64 ~~~~vnIPl~~G~~~~l   80 (116)
T PF10512_consen   64 EDANVNIPLGNGKPIRL   80 (116)
T ss_dssp             -S-EE---SSSSS---E
T ss_pred             CCccEEEecCCCeEEEc
Confidence            45679999999987776


No 6  
>PF06007 PhnJ:  Phosphonate metabolism protein PhnJ;  InterPro: IPR010306 This family consists of several bacterial phosphonate metabolism (PhnJ) sequences. The exact role that PhnJ plays in phosphonate utilisation is unknown.; GO: 0042916 alkylphosphonate transport
Probab=27.39  E-value=54  Score=25.14  Aligned_cols=42  Identities=31%  Similarity=0.606  Sum_probs=27.0

Q ss_pred             CCCCCCCC---CCCCCCeeeeecC---CCCeeeec-------ccccccchhccccc
Q psy13712          3 PFSSSSNP---GFPSYGNLQIPLA---NGNIMKIP-------VTSINISEEVNKTG   45 (63)
Q Consensus         3 ~~~~~~~~---~~~~e~~vqiPle---~g~vl~IP-------l~~INISDEM~KT~   45 (63)
                      ||.|---|   |+||+| ||+-++   ..++||+=       +..|||+.=..+|+
T Consensus        33 PFaSREMP~~~GWGTGG-lQvT~sliG~~D~lKVIDQGaDds~NAvniR~f~~~t~   87 (277)
T PF06007_consen   33 PFASREMPMPRGWGTGG-LQVTLSLIGPDDVLKVIDQGADDSTNAVNIRRFFARTA   87 (277)
T ss_pred             CcccccCccccccccCc-eeEEEEeecCCceeEEeecCCCcchhHHHHHHHHHHhc
Confidence            77776655   888988 777763   26666652       15567775555554


No 7  
>PF07026 DUF1317:  Protein of unknown function (DUF1317);  InterPro: IPR009750 This entry is represented by Bacteriophage lambda, Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=23.33  E-value=32  Score=21.03  Aligned_cols=28  Identities=25%  Similarity=0.680  Sum_probs=21.2

Q ss_pred             Ceeeeec---------CCCCeeeecccccccchhccc
Q psy13712         16 GNLQIPL---------ANGNIMKIPVTSINISEEVNK   43 (63)
Q Consensus        16 ~~vqiPl---------e~g~vl~IPl~~INISDEM~K   43 (63)
                      |.+++|+         -+|.+++-|+...++-+|++-
T Consensus        11 G~itl~ys~~~~GWl~Pgg~vi~NPlkAqR~AE~~n~   47 (60)
T PF07026_consen   11 GTITLPYSHFKNGWLMPGGKVITNPLKAQRLAEELNS   47 (60)
T ss_pred             eEEEEEEEeccceeecCCCeeEcCHHHHHHHHHHHHh
Confidence            4567774         468889999988888888763


No 8  
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st
Probab=22.67  E-value=61  Score=19.13  Aligned_cols=23  Identities=17%  Similarity=0.546  Sum_probs=15.9

Q ss_pred             CCCCCCCCeeeeecCCCCeeeecc
Q psy13712          9 NPGFPSYGNLQIPLANGNIMKIPV   32 (63)
Q Consensus         9 ~~~~~~e~~vqiPle~g~vl~IPl   32 (63)
                      -||+..+ .++|-++++++|.|--
T Consensus        17 lPGv~~e-di~i~v~~~~~L~I~g   39 (92)
T cd06472          17 VPGVKKE-DVKVEVEDGRVLRISG   39 (92)
T ss_pred             CCCCChH-hEEEEEeCCCEEEEEE
Confidence            4888766 4777777766766644


No 9  
>KOG3908|consensus
Probab=21.78  E-value=18  Score=28.78  Aligned_cols=22  Identities=36%  Similarity=0.798  Sum_probs=19.2

Q ss_pred             cccccceeeccCCCCCCCCCCC
Q psy13712         42 NKTGIWKQVNKGDKKVPPSKPR   63 (63)
Q Consensus        42 ~KT~iWK~l~~nt~~~~~~~~~   63 (63)
                      +|...|.-|.-.++.+|+.|||
T Consensus       228 eK~~Fwr~V~~ct~~LP~dkPR  249 (396)
T KOG3908|consen  228 EKSEFWRMVAFCTSSLPPDKPR  249 (396)
T ss_pred             hHHHHHHHHHHHHccCCCCCCc
Confidence            3566799999999999999998


No 10 
>PF15493 YrpD:  Domain of unknown function, YrpD
Probab=20.48  E-value=1.3e+02  Score=22.28  Aligned_cols=44  Identities=32%  Similarity=0.496  Sum_probs=27.8

Q ss_pred             CCCCCCCCeeeeec---CCCCe-eeeccc---------------ccccchhcccccc-----ceeecc
Q psy13712          9 NPGFPSYGNLQIPL---ANGNI-MKIPVT---------------SINISEEVNKTGI-----WKQVNK   52 (63)
Q Consensus         9 ~~~~~~e~~vqiPl---e~g~v-l~IPl~---------------~INISDEM~KT~i-----WK~l~~   52 (63)
                      .+||-++..||+-+   -+|++ |++---               ..-|=.|..++.+     ||.|+-
T Consensus        93 ~ngf~pGqdVqm~~y~n~nGn~Rltl~Gta~c~d~~ct~~~dty~~~ii~e~~~~ni~sv~~wK~LaT  160 (208)
T PF15493_consen   93 KNGFKPGQDVQMTLYKNYNGNTRLTLWGTAICADRSCTNNGDTYTGRIISEISNTNIGSVSKWKLLAT  160 (208)
T ss_pred             cCCCCCCCeEEEEEEEeCCCCEEEEEEeeeeccccccccCCCceEEEEEEeeccCCccceeeeeeeeE
Confidence            58999999999877   34665 333220               0111157777777     999874


Done!