Query         psy13719
Match_columns 139
No_of_seqs    114 out of 852
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:43:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13719.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13719hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03028 Dynein_heavy:  Dynein   99.9 4.3E-23 9.4E-28  184.9   3.8   95    6-101   611-707 (707)
  2 PF08407 Chitin_synth_1N:  Chit  35.8      15 0.00033   24.8   0.5   55   72-126    13-75  (79)
  3 PRK02615 thiamine-phosphate py  25.1      20 0.00044   30.4  -0.4   18  116-133    95-112 (347)
  4 PRK13680 hypothetical protein;  20.4 2.4E+02  0.0052   20.5   4.4   40   43-84     69-108 (117)
  5 PRK10113 cell division modulat  15.9      74  0.0016   21.2   0.8   18   86-103    32-51  (80)
  6 PF11623 DUF3252:  Protein of u  14.1      96  0.0021   19.5   0.9   11   16-26     33-43  (53)
  7 KOG4077|consensus               13.9      55  0.0012   24.6  -0.2   23  111-133    35-57  (149)
  8 cd05792 S1_eIF1AD_like S1_eIF1  11.5 2.3E+02   0.005   18.9   2.3   27   77-104    25-51  (78)
  9 PF07962 Swi3:  Replication For  11.1      60  0.0013   21.8  -0.7   23  107-129    46-68  (83)
 10 PF10729 CedA:  Cell division a  10.8      96  0.0021   20.7   0.2   16   86-101    32-49  (80)

No 1  
>PF03028 Dynein_heavy:  Dynein heavy chain and region D6 of dynein motor;  InterPro: IPR004273 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits, intermediate size subunits and small subunits (see IPR001372 from INTERPRO). This family represents the C-terminal region of dynein heavy chain. The dynein heavy chain also exhibits ATPase activity and microtubule binding ability and acts as a motor for the movement of organelles and vesicles along microtubules. ; GO: 0003777 microtubule motor activity, 0007018 microtubule-based movement, 0030286 dynein complex; PDB: 3VKG_A 3VKH_C 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=99.87  E-value=4.3e-23  Score=184.86  Aligned_cols=95  Identities=41%  Similarity=0.768  Sum_probs=68.8

Q ss_pred             CCCCCeEEEeceeEecceeeCCCCcccCCCCccceecCCeEEEEeeecCCCCCCCeEeeeeeeeccccc--eEEEEEecC
Q psy13719          6 FYSQEGVYVCGLFLEGAGWNKSNRSLCEPLPLQLIYKLPVLHCKPVVNQHKPLDTLYECPVYYTAKRGE--YIVPVGLDS   83 (139)
Q Consensus         6 ~~p~~Gv~V~GL~LEGA~WD~~~~~L~e~~~~~l~~~lPvi~l~p~~~~~~~~~~~y~cPVY~t~~R~n--~V~~v~Lpt   83 (139)
                      .++++|+||+||+||||+||.+.+++.++.++.++++||++|+.|+........+.|.||||+++.|++  +|++++||+
T Consensus       611 ~~~~~g~~I~GL~leGA~wd~~~~~l~~~~~~~~~~~~pv~~~~~~~~~~~~~~~~y~~PvY~~~~R~~~~~v~~l~l~~  690 (707)
T PF03028_consen  611 SPPEDGVYIHGLFLEGARWDGQKGCLEESSPKSLYPPMPVIWLKPVQASPQSSDNSYECPVYKTSSREGLNFVFSLPLPT  690 (707)
T ss_dssp             ----EEEEE-SEEEESSEEET-TCEE--SSSEEEES-EEEE-EE-----TTCGGCSEEEEEESSTT--S--EEEEEEE-B
T ss_pred             cccccceEEEeEEecccEeccccCcccCCCcccccccCceeEeccccccccCCCCEEECCceecCcCCCCeEEEEEEcCC
Confidence            357899999999999999999999999999999999999999999876555566889999999999977  999999999


Q ss_pred             CCCCCCceEEeeeeeccc
Q psy13719         84 GEIPPDHWVKRGTAILLT  101 (139)
Q Consensus        84 ~~~~~~~Wi~rGVALll~  101 (139)
                      + .++++|++|||||+|+
T Consensus       691 ~-~~~~~Wi~rGvAl~lq  707 (707)
T PF03028_consen  691 D-EDPDHWILRGVALLLQ  707 (707)
T ss_dssp             --T-HHHHHTTT-EEES-
T ss_pred             C-CCHHHHHHHhHHHhcC
Confidence            6 7999999999999986


No 2  
>PF08407 Chitin_synth_1N:  Chitin synthase N-terminal;  InterPro: IPR013616 This is the N-terminal domain of Chitin synthase (IPR004834 from INTERPRO). ; GO: 0004100 chitin synthase activity
Probab=35.84  E-value=15  Score=24.80  Aligned_cols=55  Identities=22%  Similarity=0.133  Sum_probs=39.9

Q ss_pred             ccceEEEEEecCC--------CCCCCceEEeeeeeccccCcccccccchhcccccceehhhhh
Q psy13719         72 RGEYIVPVGLDSG--------EIPPDHWVKRGTAILLTLSSDTCQGLFERHKLLFGVRIIEIF  126 (139)
Q Consensus        72 R~n~V~~v~Lpt~--------~~~~~~Wi~rGVALll~~~~~~~~~~~~~~~~~~~~~~~~~~  126 (139)
                      +.|+|+...+|..        ..+.+.=.+|=.|+.|+.+|=...|.-+|+.+...-|-+|+|
T Consensus        13 ~Gnlv~D~PVP~~ll~~~~~~~~~~Eft~mRYTAvTcdP~dF~~~gytLR~~~y~~pR~tEl~   75 (79)
T PF08407_consen   13 NGNLVLDCPVPSALLNSLPRGRDEREFTHMRYTAVTCDPDDFTEDGYTLRQVLYGPPRETELF   75 (79)
T ss_pred             cCcEEEECcCCHHHHhhCCCCCCCcchheEEeeeEEeCHHHHhHcCcEechhhcCCCCccEEE
Confidence            4678887776653        124455568888999999997788877888877667777765


No 3  
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional
Probab=25.09  E-value=20  Score=30.43  Aligned_cols=18  Identities=28%  Similarity=0.615  Sum_probs=15.5

Q ss_pred             cccceehhhhhcccccee
Q psy13719        116 LLFGVRIIEIFGKSYNAA  133 (139)
Q Consensus       116 ~~~~~~~~~~~~~~~~~~  133 (139)
                      .|.+.|.+|||||-|+..
T Consensus        95 ~qea~rvlee~~k~~~~~  112 (347)
T PRK02615         95 VQEALRVLEEYGKLYDPE  112 (347)
T ss_pred             HHHHHHHHHHHHccCCHH
Confidence            578899999999998754


No 4  
>PRK13680 hypothetical protein; Provisional
Probab=20.37  E-value=2.4e+02  Score=20.53  Aligned_cols=40  Identities=18%  Similarity=0.135  Sum_probs=26.2

Q ss_pred             CCeEEEEeeecCCCCCCCeEeeeeeeeccccceEEEEEecCC
Q psy13719         43 LPVLHCKPVVNQHKPLDTLYECPVYYTAKRGEYIVPVGLDSG   84 (139)
Q Consensus        43 lPvi~l~p~~~~~~~~~~~y~cPVY~t~~R~n~V~~v~Lpt~   84 (139)
                      -|++|+.....  ...++.|..|+=....+...--.+.+-|.
T Consensus        69 ~PVaWin~~~i--tg~~~~~~VPltVRG~k~d~~Y~V~vdC~  108 (117)
T PRK13680         69 DPVAWVNVQDI--TGKDDKWQVPLTVRGKSADIHYQVVVDCK  108 (117)
T ss_pred             CCeEEEccccc--ccccceEEEEEEEecccCceEEEEEEEcc
Confidence            48888876443  23567899998877777555445555554


No 5  
>PRK10113 cell division modulator; Provisional
Probab=15.85  E-value=74  Score=21.19  Aligned_cols=18  Identities=33%  Similarity=0.475  Sum_probs=12.5

Q ss_pred             CCCCceEEee--eeeccccC
Q psy13719         86 IPPDHWVKRG--TAILLTLS  103 (139)
Q Consensus        86 ~~~~~Wi~rG--VALll~~~  103 (139)
                      .-.+.|++||  ||+++.-+
T Consensus        32 ~frDVW~LrGKYVAFvl~ge   51 (80)
T PRK10113         32 SFRDVWMLRGKYVAFVLMGE   51 (80)
T ss_pred             chhhhheeccceEEEEEech
Confidence            3457799998  67776443


No 6  
>PF11623 DUF3252:  Protein of unknown function (DUF3252);  InterPro: IPR021659  This family of proteins has no known function. Some members are annotated as Ssl0352 however this cannot be confirmed. Currently there is no known function. ; PDB: 3C4S_B 2JZ2_A.
Probab=14.12  E-value=96  Score=19.47  Aligned_cols=11  Identities=36%  Similarity=1.120  Sum_probs=8.9

Q ss_pred             ceeEecceeeC
Q psy13719         16 GLFLEGAGWNK   26 (139)
Q Consensus        16 GL~LEGA~WD~   26 (139)
                      |..+||+.||.
T Consensus        33 aVLFEGGnWdK   43 (53)
T PF11623_consen   33 AVLFEGGNWDK   43 (53)
T ss_dssp             EEEEEETTEEE
T ss_pred             EEEecCCCceE
Confidence            45689999994


No 7  
>KOG4077|consensus
Probab=13.86  E-value=55  Score=24.64  Aligned_cols=23  Identities=22%  Similarity=0.322  Sum_probs=19.8

Q ss_pred             chhcccccceehhhhhcccccee
Q psy13719        111 FERHKLLFGVRIIEIFGKSYNAA  133 (139)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~  133 (139)
                      |-+.++.||..|-|+|.+.|+.-
T Consensus        35 ~~~~~~~hg~et~EEfd~ry~~y   57 (149)
T KOG4077|consen   35 FIKYSMEHGPETAEEFDARYEKY   57 (149)
T ss_pred             hhhhHhhcCcccHHHHHHHHHHH
Confidence            55789999999999999988754


No 8  
>cd05792 S1_eIF1AD_like S1_eIF1AD_like: eukaryotic translation initiation factor 1A domain containing protein (eIF1AD)-like, S1-like RNA-binding domain. eIF1AD is also known as MGC11102 protein. Little is known about the function of eIF1AD. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins, including translation initiation factor IF1A (also referred to as eIF1A in eukaryotes). eIF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors.
Probab=11.46  E-value=2.3e+02  Score=18.95  Aligned_cols=27  Identities=22%  Similarity=0.455  Sum_probs=20.6

Q ss_pred             EEEEecCCCCCCCceEEeeeeeccccCc
Q psy13719         77 VPVGLDSGEIPPDHWVKRGTAILLTLSS  104 (139)
Q Consensus        77 ~~v~Lpt~~~~~~~Wi~rGVALll~~~~  104 (139)
                      +.+.||.. -....||.||--++..+-+
T Consensus        25 ~l~~iP~K-fRk~iWIkrGd~VlV~p~~   51 (78)
T cd05792          25 YLVSMPTK-FRKNIWIKRGDFVLVEPIE   51 (78)
T ss_pred             EEEEechh-hcccEEEEeCCEEEEEecc
Confidence            33558874 7788999999988886654


No 9  
>PF07962 Swi3:  Replication Fork Protection Component Swi3;  InterPro: IPR012923 Replication fork pausing is required to initiate recombination events. More specifically, Swi1 is required for recombination near the mat1 locus. Swi3 has been found to co-purify with Swi1. Together they define a fork protection complex that coordinates leading- and lagging-strand synthesis and stabilises stalled replication forks []. This complex is required for accurate replication, fork protection and replication checkpoint signalling [, ].; GO: 0006974 response to DNA damage stimulus, 0007049 cell cycle, 0048478 replication fork protection, 0005634 nucleus
Probab=11.09  E-value=60  Score=21.79  Aligned_cols=23  Identities=22%  Similarity=0.296  Sum_probs=21.2

Q ss_pred             ccccchhcccccceehhhhhccc
Q psy13719        107 CQGLFERHKLLFGVRIIEIFGKS  129 (139)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~  129 (139)
                      |..+||+-+.-..+..||-+|++
T Consensus        46 ~h~LfPk~~F~d~i~~vE~LG~~   68 (83)
T PF07962_consen   46 AHRLFPKASFEDFIERVEKLGKK   68 (83)
T ss_pred             HHhcCCCCCHHHHHHHHHHHcCC
Confidence            77889999999999999999987


No 10 
>PF10729 CedA:  Cell division activator CedA;  InterPro: IPR019666  CedA is made up of four antiparallel beta-strands and an alpha-helix. It activates cell division by inhibiting chromosome over-replication. This is mediated by binding to dsDNA via the beta-sheet [, ]. ; GO: 0003677 DNA binding, 0051301 cell division; PDB: 2BN8_A 2D35_A.
Probab=10.81  E-value=96  Score=20.72  Aligned_cols=16  Identities=38%  Similarity=0.501  Sum_probs=11.8

Q ss_pred             CCCCceEEee--eeeccc
Q psy13719         86 IPPDHWVKRG--TAILLT  101 (139)
Q Consensus        86 ~~~~~Wi~rG--VALll~  101 (139)
                      .-.+.|++||  ||+++-
T Consensus        32 gfrdvw~lrgkyvafvl~   49 (80)
T PF10729_consen   32 GFRDVWQLRGKYVAFVLM   49 (80)
T ss_dssp             TECCECCCCCEEEEEEES
T ss_pred             cccceeeeccceEEEEEe
Confidence            4567899998  677664


Done!