Diaphorina citri psyllid: psy13751


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MNAMRDKFDNQDKEIAELKEEIRKKEMEISVLVTFAPGETLDTAFLKQNPRRSLPALVDGDLLICDSHAINAYLVSAYGKNDVLYPKDSKDRALVDQRLYFDAGEIFPTIKQIAVSPCLLVRTHIQGVSTHGLKDCILTLARYFLLSSK
ccccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHcccccccEEEEccEEEEcHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccc
*******FDNQDKEIAELKEEIRKKEMEISVLVTFAPGETLDTAFLKQNPRRSLPALVDGDLLICDSHAINAYLVSAYGKNDVLYPKDSKDRALVDQRLYFDAGEIFPTIKQIAVSPCLLVRTHIQGVSTHGLKDCILTLARYFLL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxISVLVTFAPGETLDTAFLKQNPRRSLPALVDGDLLICDSHAINAYLVSAYGKNDVLYPKDSKDRALVDQRLYFDAGEIFPTIKQIAVSPCLLVRTHIQGVSTHGLKDCILTLARYFLLSSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0003674 [MF]molecular_functionprobable
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LJR, chain A
Confidence level:very confident
Coverage over the Query: 12-146
View the alignment between query and template
View the model in PyMOL