BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13768
         (175 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CNE|A Chain A, Crystal Structure Of The Putative Protease I From
           Bacteroides Thetaiotaomicron
 pdb|3CNE|B Chain B, Crystal Structure Of The Putative Protease I From
           Bacteroides Thetaiotaomicron
 pdb|3CNE|C Chain C, Crystal Structure Of The Putative Protease I From
           Bacteroides Thetaiotaomicron
 pdb|3CNE|D Chain D, Crystal Structure Of The Putative Protease I From
           Bacteroides Thetaiotaomicron
          Length = 175

 Score = 27.3 bits (59), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 14/27 (51%)

Query: 140 PVADCGPMLYLEAHFNRWYSLKAYYVS 166
           PV  CG   YLEA F    S K + VS
Sbjct: 12  PVNGCGLFQYLEAFFENGISYKVFAVS 38


>pdb|2H8A|A Chain A, Structure Of Microsomal Glutathione Transferase 1 In
           Complex With Glutathione
          Length = 154

 Score = 26.2 bits (56), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 47  KVKRDSTLTHLRIIVNIFVALMLGVLFQNSGEYASSVLINYNLLFSILIHHVMT 100
           +V+R     HL  + NI   L +G+L+  SG   S+ LI++ +     I+H + 
Sbjct: 70  RVRR----AHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIA 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.138    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,604,800
Number of Sequences: 62578
Number of extensions: 155937
Number of successful extensions: 335
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 333
Number of HSP's gapped (non-prelim): 2
length of query: 175
length of database: 14,973,337
effective HSP length: 92
effective length of query: 83
effective length of database: 9,216,161
effective search space: 764941363
effective search space used: 764941363
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 48 (23.1 bits)