Query         psy13770
Match_columns 168
No_of_seqs    2 out of 4
Neff          1.4 
Searched_HMMs 46136
Date          Fri Aug 16 20:04:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13770.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13770hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15140 DUF4573:  Domain of un  31.9      90   0.002   24.4   4.3   32  129-160    98-129 (174)
  2 KOG2916|consensus                5.8 5.4E+02   0.012   23.3   2.7   38    9-46    199-236 (304)
  3 PF08122 NDUF_B12:  NADH-ubiqui   3.7 4.5E+02  0.0097   17.6   0.5   13   10-22      1-13  (57)
  4 smart00246 WH2 Wiskott Aldrich   3.5   3E+02  0.0065   16.7  -0.4   11    2-12      7-17  (26)
  5 PRK01773 hscB co-chaperone Hsc   3.1   5E+02   0.011   20.5   0.3   15    8-22     60-74  (173)
  6 KOG4727|consensus                3.0 6.1E+02   0.013   21.7   0.9   24    3-27     35-58  (193)
  7 KOG1830|consensus                3.0   4E+02  0.0086   25.6  -0.3   22    1-22    460-483 (518)
  8 cd01816 Raf_RBD Ubiquitin doma   2.6 6.5E+02   0.014   18.4   0.5   24    4-27     16-39  (74)
  9 KOG3192|consensus                2.6 5.7E+02   0.012   21.4   0.2   11    9-19     67-77  (168)
 10 KOG4612|consensus                2.5   1E+03   0.022   18.7   1.5   28  137-164    25-52  (105)

No 1  
>PF15140 DUF4573:  Domain of unknown function (DUF4573)
Probab=31.89  E-value=90  Score=24.40  Aligned_cols=32  Identities=34%  Similarity=0.445  Sum_probs=11.9

Q ss_pred             eeecCCceeeeecCCccccccCCCccccccCC
Q psy13770        129 VLTYPPLKGVLTYPPLKGVLTSPPLKGVLTSP  160 (168)
Q Consensus       129 VL~~P~~K~VL~ypplkgvltspplkgvltsp  160 (168)
                      +-...++..+-.-.|+.++-..-|...+-+-+
T Consensus        98 v~~i~Pl~~v~~~~P~~~v~~~~p~~~v~~v~  129 (174)
T PF15140_consen   98 VSNIDPLQAVSEIQPLEAVSKVEPSQPVETVP  129 (174)
T ss_pred             ccccCCCcccccccccccccccCccccccccC
Confidence            33333333333333333333333333333333


No 2  
>KOG2916|consensus
Probab=5.76  E-value=5.4e+02  Score=23.27  Aligned_cols=38  Identities=29%  Similarity=0.375  Sum_probs=31.0

Q ss_pred             cccchhhhhhhhhcccCceEEEEecCceeeEeeCCccc
Q psy13770          9 QLKDSLRRTELKRDLTSPLKVVLTSPPLKVVLTSPPLK   46 (168)
Q Consensus         9 ~LK~~L~r~E~K~~L~~PLKVVL~sP~~KVVL~sP~~K   46 (168)
                      ..|+.|..+|.--.=..|+|+-|-+||+-|+.|.-+-|
T Consensus       199 aIK~alk~a~~~~te~~piki~LIApPlYVlTT~tldK  236 (304)
T KOG2916|consen  199 AIKAALKAALNLSTEECPIKIKLIAPPLYVLTTQTLDK  236 (304)
T ss_pred             HHHHHHHHHHhCCcccCceEEEEecCceEEEEEeeccc
Confidence            35788888887777788999999999999998876544


No 3  
>PF08122 NDUF_B12:  NADH-ubiquinone oxidoreductase B12 subunit family;  InterPro: IPR012576  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of the B12 subunit of NADH:ubiquinone oxidoreductase proteins. The function of this subunit is unclear [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=3.66  E-value=4.5e+02  Score=17.57  Aligned_cols=13  Identities=46%  Similarity=0.437  Sum_probs=9.3

Q ss_pred             ccchhhhhhhhhc
Q psy13770         10 LKDSLRRTELKRD   22 (168)
Q Consensus        10 LK~~L~r~E~K~~   22 (168)
                      ||||-+|.|+=|-
T Consensus         1 lkDPW~RneaWRy   13 (57)
T PF08122_consen    1 LKDPWARNEAWRY   13 (57)
T ss_pred             CCChHhhhHHHhC
Confidence            5778888777654


No 4  
>smart00246 WH2 Wiskott Aldrich syndrome homology region 2. Wiskott Aldrich syndrome homology region 2 / actin-binding motif
Probab=3.51  E-value=3e+02  Score=16.70  Aligned_cols=11  Identities=36%  Similarity=0.676  Sum_probs=7.3

Q ss_pred             ccccccccccc
Q psy13770          2 RALRSGAQLKD   12 (168)
Q Consensus         2 ralRs~~~LK~   12 (168)
                      .++|+|.+||-
T Consensus         7 a~Ir~G~~LKk   17 (26)
T smart00246        7 AQIRQGKKLKK   17 (26)
T ss_pred             HHHHcccccCc
Confidence            45677777764


No 5  
>PRK01773 hscB co-chaperone HscB; Provisional
Probab=3.07  E-value=5e+02  Score=20.51  Aligned_cols=15  Identities=33%  Similarity=0.306  Sum_probs=11.0

Q ss_pred             ccccchhhhhhhhhc
Q psy13770          8 AQLKDSLRRTELKRD   22 (168)
Q Consensus         8 ~~LK~~L~r~E~K~~   22 (168)
                      ..||+|++||+-=-.
T Consensus        60 ~tLkdPl~RA~YLL~   74 (173)
T PRK01773         60 QILKDPILRAEAIIA   74 (173)
T ss_pred             HHHCChHHHHHHHHH
Confidence            468999999875433


No 6  
>KOG4727|consensus
Probab=3.05  E-value=6.1e+02  Score=21.65  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=19.3

Q ss_pred             cccccccccchhhhhhhhhcccCce
Q psy13770          3 ALRSGAQLKDSLRRTELKRDLTSPL   27 (168)
Q Consensus         3 alRs~~~LK~~L~r~E~K~~L~~PL   27 (168)
                      +.-+.+| .+.|.+-+.|+||.+-|
T Consensus        35 k~~~~vq-re~L~~rdykvdl~sKL   58 (193)
T KOG4727|consen   35 KDGPPVQ-REHLKHRDYKVDLESKL   58 (193)
T ss_pred             hcCCchh-HHHHhhhhhhhHhHhhc
Confidence            3445666 78899999999999988


No 7  
>KOG1830|consensus
Probab=3.03  E-value=4e+02  Score=25.64  Aligned_cols=22  Identities=45%  Similarity=0.690  Sum_probs=14.9

Q ss_pred             Cccccccccccch--hhhhhhhhc
Q psy13770          1 MRALRSGAQLKDS--LRRTELKRD   22 (168)
Q Consensus         1 mralRs~~~LK~~--L~r~E~K~~   22 (168)
                      |.|+|+|.|||.-  -+..|+|+.
T Consensus       460 L~aIr~GiqLrKVeeqreqeakr~  483 (518)
T KOG1830|consen  460 LAAIRSGIQLRKVEEQREQEAKRE  483 (518)
T ss_pred             HHHHHhcchhHHHHHHHHHHHhhc
Confidence            4689999999864  334455654


No 8  
>cd01816 Raf_RBD Ubiquitin domain of  Raf serine/threonine kinases. The Raf serine/threonine kinases are composed of three conserved regions, CR1, CR2 and CR3.  CR1 has two Ras binding domains (RBD and CRD), CR2 is a serine/threonine rich domain and CR3 is the catalytic kinase domain.  The RBD of Raf is structurally similar to ubiquitin with little of no sequence similarity.The Raf signalling pathway plays an important role in the proliferation and survival of tumor cells.
Probab=2.64  E-value=6.5e+02  Score=18.40  Aligned_cols=24  Identities=29%  Similarity=0.454  Sum_probs=19.9

Q ss_pred             ccccccccchhhhhhhhhcccCce
Q psy13770          4 LRSGAQLKDSLRRTELKRDLTSPL   27 (168)
Q Consensus         4 lRs~~~LK~~L~r~E~K~~L~~PL   27 (168)
                      .|+|..++|.|.|+=-+|-|+--.
T Consensus        16 vrpG~tl~daL~KaLk~R~l~pe~   39 (74)
T cd01816          16 VRPGMTLRDALAKALKVRGLQPEC   39 (74)
T ss_pred             ecCCcCHHHHHHHHHHHcCCChhH
Confidence            589999999999998888887444


No 9  
>KOG3192|consensus
Probab=2.60  E-value=5.7e+02  Score=21.37  Aligned_cols=11  Identities=45%  Similarity=0.649  Sum_probs=8.8

Q ss_pred             cccchhhhhhh
Q psy13770          9 QLKDSLRRTEL   19 (168)
Q Consensus         9 ~LK~~L~r~E~   19 (168)
                      .|||+|+||+-
T Consensus        67 TLk~pL~RA~Y   77 (168)
T KOG3192|consen   67 TLKDPLARARY   77 (168)
T ss_pred             HHHhHHHHHHH
Confidence            48899999873


No 10 
>KOG4612|consensus
Probab=2.52  E-value=1e+03  Score=18.66  Aligned_cols=28  Identities=39%  Similarity=0.567  Sum_probs=0.0

Q ss_pred             eeeecCCccccccCCCccccccCCCCCC
Q psy13770        137 GVLTYPPLKGVLTSPPLKGVLTSPPLKG  164 (168)
Q Consensus       137 ~VL~ypplkgvltspplkgvltspplkg  164 (168)
                      +|+.+++-...+.|+|+++-+-+|-.-|
T Consensus        25 ~~~R~~qtr~~ln~~~l~~~lpTp~~fg   52 (105)
T KOG4612|consen   25 SVLRWPQTRMLLNSSPLKTPLPTPLGFG   52 (105)
T ss_pred             cccccCCCcCccCCccccCCCCCccchh


Done!