Query         psy13804
Match_columns 129
No_of_seqs    177 out of 456
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 20:54:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13804.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13804hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3643|consensus               99.1 3.2E-11 6.9E-16  105.4   4.2   30   84-113   430-459 (459)
  2 KOG3642|consensus               99.1   7E-11 1.5E-15  103.6   3.0   40   80-119   424-463 (466)
  3 KOG3644|consensus               98.9 9.1E-10   2E-14   96.6   2.9   30   84-113   427-456 (457)
  4 PF02932 Neur_chan_memb:  Neuro  98.7   9E-09 1.9E-13   73.4   3.4   28   81-108   210-237 (237)
  5 TIGR00860 LIC Cation transport  97.3 9.2E-05   2E-09   64.5   1.6   29   83-111   431-459 (459)
  6 PF15202 Adipogenin:  Adipogeni  60.5      13 0.00027   25.9   3.2   29   94-122    21-49  (81)
  7 PF08370 PDR_assoc:  Plant PDR   55.2      15 0.00032   24.6   2.8   24   98-121    37-61  (65)
  8 PF04750 Far-17a_AIG1:  FAR-17a  52.0      10 0.00023   28.9   1.9   25   89-114    69-94  (201)
  9 COG3924 Predicted membrane pro  47.6      29 0.00063   24.3   3.3   30   90-121    47-76  (80)
 10 PF14293 YWFCY:  YWFCY protein   41.4      28  0.0006   23.3   2.4   22   91-114    15-36  (61)
 11 PF10740 DUF2529:  Protein of u  38.9      13 0.00028   29.4   0.6   27   89-116   144-170 (172)
 12 PHA00724 hypothetical protein   33.8      48   0.001   23.1   2.7   21   94-114    60-80  (83)
 13 PF14715 FixP_N:  N-terminal do  33.6      41  0.0009   21.4   2.2   23   91-114    23-45  (51)
 14 TIGR03779 Bac_Flav_CT_M Bacter  32.6      32  0.0007   30.6   2.1   19   94-112     9-27  (410)
 15 PF06716 DUF1201:  Protein of u  31.9      65  0.0014   20.8   2.9   16   96-111    15-30  (54)
 16 KOG3249|consensus               30.7      43 0.00093   26.7   2.3   21   91-111   120-140 (181)
 17 COG4300 CadD Predicted permeas  29.6      43 0.00094   27.2   2.2   21   85-105   168-188 (205)
 18 KOG3989|consensus               28.9      31 0.00067   28.3   1.3   31   88-119    77-108 (224)
 19 PF12339 DNAJ_related:  DNA-J r  28.7      49  0.0011   24.8   2.3   17   93-109    46-62  (132)
 20 TIGR00782 ccoP cytochrome c ox  28.1      50  0.0011   27.0   2.4   25   90-115    28-52  (285)
 21 PHA02690 hypothetical protein;  23.3   1E+02  0.0023   21.9   2.9   27   87-113    37-63  (90)
 22 PF14393 DUF4422:  Domain of un  21.5      80  0.0017   25.7   2.4   26   80-105   170-195 (231)
 23 PF06638 Strabismus:  Strabismu  21.3      90   0.002   28.6   2.9   22   93-114   167-188 (505)
 24 PF06196 DUF997:  Protein of un  20.9 1.4E+02  0.0031   20.5   3.2   30   90-121    47-76  (80)

No 1  
>KOG3643|consensus
Probab=99.14  E-value=3.2e-11  Score=105.43  Aligned_cols=30  Identities=57%  Similarity=1.154  Sum_probs=28.0

Q ss_pred             CchhHHhHHHHHhhHHHHHHHHHHHHHhhh
Q psy13804         84 TPSDIDKYSRIVFPVCFVCFNLMYWIIYLH  113 (129)
Q Consensus        84 ~~~~ID~~SRi~FP~~F~iFNi~YW~~yl~  113 (129)
                      .++.||+|||++||++|++||++||.||++
T Consensus       430 ~~~~IDkySR~~FP~~F~lFNivYW~yy~~  459 (459)
T KOG3643|consen  430 DVSKIDKYSRIVFPLAFSLFNIVYWLYYMY  459 (459)
T ss_pred             CcchhhHHHHHHHHHHHHHHHHHHhheeeC
Confidence            388999999999999999999999999964


No 2  
>KOG3642|consensus
Probab=99.06  E-value=7e-11  Score=103.59  Aligned_cols=40  Identities=50%  Similarity=1.021  Sum_probs=34.4

Q ss_pred             cccCCchhHHhHHHHHhhHHHHHHHHHHHHHhhhcccccc
Q psy13804         80 LYGITPSDIDKYSRIVFPVCFVCFNLMYWIIYLHISDVVA  119 (129)
Q Consensus        80 ~~~~~~~~ID~~SRi~FP~~F~iFNi~YW~~yl~~~~~~~  119 (129)
                      .......+||+||||+||++|++||++||..||+++.++.
T Consensus       424 ~~~~~vskiD~~sRivFPv~F~~fNlvYW~~yL~~~~~i~  463 (466)
T KOG3642|consen  424 RLYISVSKIDNYSRIVFPVLFILFNLVYWVVYLNLEPIIK  463 (466)
T ss_pred             CcccchhhhhccchhhhHHHHHHHHHHHHhhhccccchhc
Confidence            3345778999999999999999999999999999865543


No 3  
>KOG3644|consensus
Probab=98.88  E-value=9.1e-10  Score=96.58  Aligned_cols=30  Identities=47%  Similarity=1.049  Sum_probs=28.4

Q ss_pred             CchhHHhHHHHHhhHHHHHHHHHHHHHhhh
Q psy13804         84 TPSDIDKYSRIVFPVCFVCFNLMYWIIYLH  113 (129)
Q Consensus        84 ~~~~ID~~SRi~FP~~F~iFNi~YW~~yl~  113 (129)
                      .+++||++||++||++|++||++||++|+.
T Consensus       427 ~~~~ID~~sr~~FP~~F~~FN~~YW~~y~~  456 (457)
T KOG3644|consen  427 TAERIDRISRFLFPLLFLLFNIIYWTYYLK  456 (457)
T ss_pred             chHHHhHHHHHHHHHHHHHHHHHHhhheEe
Confidence            688999999999999999999999999974


No 4  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=98.72  E-value=9e-09  Score=73.42  Aligned_cols=28  Identities=39%  Similarity=0.988  Sum_probs=25.7

Q ss_pred             ccCCchhHHhHHHHHhhHHHHHHHHHHH
Q psy13804         81 YGITPSDIDKYSRIVFPVCFVCFNLMYW  108 (129)
Q Consensus        81 ~~~~~~~ID~~SRi~FP~~F~iFNi~YW  108 (129)
                      +...+..||+++|++||++|++||++||
T Consensus       210 w~~~A~viDR~~~~~F~i~f~~~~i~yw  237 (237)
T PF02932_consen  210 WKFVAMVIDRLFRILFPIAFILFNIVYW  237 (237)
T ss_dssp             HHSTSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHhhhC
Confidence            3456889999999999999999999999


No 5  
>TIGR00860 LIC Cation transporter family protein. selective while glycine receptors are anion selective).
Probab=97.32  E-value=9.2e-05  Score=64.47  Aligned_cols=29  Identities=45%  Similarity=0.970  Sum_probs=26.8

Q ss_pred             CCchhHHhHHHHHhhHHHHHHHHHHHHHh
Q psy13804         83 ITPSDIDKYSRIVFPVCFVCFNLMYWIIY  111 (129)
Q Consensus        83 ~~~~~ID~~SRi~FP~~F~iFNi~YW~~y  111 (129)
                      ..+..||+++|++||++|++||++||.+|
T Consensus       431 ~~a~viDr~~~~~f~~~~~~~~~~~~~~y  459 (459)
T TIGR00860       431 FRAKVIDKLSRMAFPLAFLLFNIGYWMSY  459 (459)
T ss_pred             hccchhhHHHHHHHHHHHHHhhhhheEeC
Confidence            45778999999999999999999999987


No 6  
>PF15202 Adipogenin:  Adipogenin
Probab=60.54  E-value=13  Score=25.90  Aligned_cols=29  Identities=28%  Similarity=0.602  Sum_probs=23.5

Q ss_pred             HHhhHHHHHHHHHHHHHhhhccccccccc
Q psy13804         94 IVFPVCFVCFNLMYWIIYLHISDVVADDL  122 (129)
Q Consensus        94 i~FP~~F~iFNi~YW~~yl~~~~~~~~~~  122 (129)
                      +..|++.++|-++-|.-||.-.|..++|.
T Consensus        21 lclpv~lllfl~ivwlrfllsqdsee~ds   49 (81)
T PF15202_consen   21 LCLPVGLLLFLLIVWLRFLLSQDSEENDS   49 (81)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcccccccCc
Confidence            34589999999999999998777776654


No 7  
>PF08370 PDR_assoc:  Plant PDR ABC transporter associated;  InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This domain is found on the C terminus of ABC-2 type transporter domains (IPR013525 from INTERPRO). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [] (see also IPR010929 from INTERPRO). The PDR family is characterised by a configuration in which the ABC domain is nearer the N terminus of the protein than the transmembrane domain []. 
Probab=55.16  E-value=15  Score=24.61  Aligned_cols=24  Identities=17%  Similarity=0.386  Sum_probs=17.0

Q ss_pred             HHH-HHHHHHHHHHhhhcccccccc
Q psy13804         98 VCF-VCFNLMYWIIYLHISDVVADD  121 (129)
Q Consensus        98 ~~F-~iFNi~YW~~yl~~~~~~~~~  121 (129)
                      +.| ++||++|...-.++......+
T Consensus        37 ~G~~vlFNil~~laL~yL~p~~k~~   61 (65)
T PF08370_consen   37 LGFIVLFNILFTLALTYLNPLGKSQ   61 (65)
T ss_pred             HHHHHHHHHHHHHHHHhcCCcCCCC
Confidence            455 789999998877776555444


No 8  
>PF04750 Far-17a_AIG1:  FAR-17a/AIG1-like protein;  InterPro: IPR006838 This entry includes the hamster androgen-induced FAR-17a protein (Q60534 from SWISSPROT) []. The function of these proteins is unknown but it is thought to have a central role in the fusion process during myogenesis, within the somatic mesoderm. This entry also includes homologous regions from a number of other metazoan proteins.; GO: 0016021 integral to membrane
Probab=51.98  E-value=10  Score=28.91  Aligned_cols=25  Identities=32%  Similarity=0.740  Sum_probs=20.2

Q ss_pred             HhH-HHHHhhHHHHHHHHHHHHHhhhc
Q psy13804         89 DKY-SRIVFPVCFVCFNLMYWIIYLHI  114 (129)
Q Consensus        89 D~~-SRi~FP~~F~iFNi~YW~~yl~~  114 (129)
                      |.. +-++||+.+++. ++||..|+.-
T Consensus        69 ~~~~~~~~~pl~~~V~-~~yW~l~~~d   94 (201)
T PF04750_consen   69 DWLFYSLAFPLEFIVT-VVYWSLYLID   94 (201)
T ss_pred             HHHHHHHHHHHHhcch-hhhhhHHhCC
Confidence            444 569999999998 9999999643


No 9  
>COG3924 Predicted membrane protein [Function unknown]
Probab=47.57  E-value=29  Score=24.28  Aligned_cols=30  Identities=20%  Similarity=0.507  Sum_probs=23.4

Q ss_pred             hHHHHHhhHHHHHHHHHHHHHhhhcccccccc
Q psy13804         90 KYSRIVFPVCFVCFNLMYWIIYLHISDVVADD  121 (129)
Q Consensus        90 ~~SRi~FP~~F~iFNi~YW~~yl~~~~~~~~~  121 (129)
                      ..|-|..|++|++  ++||++=+...|+..+|
T Consensus        47 E~aCi~lPllFi~--l~~~mvkfif~DI~LEd   76 (80)
T COG3924          47 EMACILLPLLFIV--LCWAMVKFIFRDIPLED   76 (80)
T ss_pred             HHHHHHHHHHHHH--HHHHHHHHhhcCCCccc
Confidence            5788999999987  67888887777766544


No 10 
>PF14293 YWFCY:  YWFCY protein
Probab=41.37  E-value=28  Score=23.33  Aligned_cols=22  Identities=23%  Similarity=0.762  Sum_probs=13.8

Q ss_pred             HHHHHhhHHHHHHHHHHHHHhhhc
Q psy13804         91 YSRIVFPVCFVCFNLMYWIIYLHI  114 (129)
Q Consensus        91 ~SRi~FP~~F~iFNi~YW~~yl~~  114 (129)
                      +.|. .-++|++.| +||.+|-.+
T Consensus        15 f~R~-iSI~~l~ih-~Y~~CY~af   36 (61)
T PF14293_consen   15 FMRA-ISILFLVIH-FYWFCYEAF   36 (61)
T ss_pred             HHHH-HHHHHHHHH-HHHHHHHHH
Confidence            4453 356677776 588888533


No 11 
>PF10740 DUF2529:  Protein of unknown function (DUF2529);  InterPro: IPR019676  This entry represents a protein family conserved in the Bacillales. Their function is not known. ; PDB: 3JX9_A.
Probab=38.85  E-value=13  Score=29.41  Aligned_cols=27  Identities=22%  Similarity=0.550  Sum_probs=16.8

Q ss_pred             HhHHHHHhhHHHHHHHHHHHHHhhhccc
Q psy13804         89 DKYSRIVFPVCFVCFNLMYWIIYLHISD  116 (129)
Q Consensus        89 D~~SRi~FP~~F~iFNi~YW~~yl~~~~  116 (129)
                      |-++||.||.+.+ +|-+|..+|+.+.+
T Consensus       144 EdG~Rig~P~~~a-~lyiYy~l~~~~~E  170 (172)
T PF10740_consen  144 EDGDRIGFPHLMA-ALYIYYALYFTLDE  170 (172)
T ss_dssp             TTS-EE---HHHH-HHHHHHHHHHHHHH
T ss_pred             CCCCEecchHHHH-HHHHHHHHHHHHHh
Confidence            3489999999864 67888888876643


No 12 
>PHA00724 hypothetical protein
Probab=33.76  E-value=48  Score=23.12  Aligned_cols=21  Identities=19%  Similarity=0.499  Sum_probs=17.7

Q ss_pred             HHhhHHHHHHHHHHHHHhhhc
Q psy13804         94 IVFPVCFVCFNLMYWIIYLHI  114 (129)
Q Consensus        94 i~FP~~F~iFNi~YW~~yl~~  114 (129)
                      -++|++|-+.|..|..-++..
T Consensus        60 ~~lpl~fgl~n~~fffnwlre   80 (83)
T PHA00724         60 SFLPLAFGLINFAFFFNWLRE   80 (83)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            478999999999998887754


No 13 
>PF14715 FixP_N:  N-terminal domain of cytochrome oxidase-cbb3, FixP 
Probab=33.61  E-value=41  Score=21.40  Aligned_cols=23  Identities=17%  Similarity=0.382  Sum_probs=15.1

Q ss_pred             HHHHHhhHHHHHHHHHHHHHhhhc
Q psy13804         91 YSRIVFPVCFVCFNLMYWIIYLHI  114 (129)
Q Consensus        91 ~SRi~FP~~F~iFNi~YW~~yl~~  114 (129)
                      .=.++|= +-++|-++||++|-..
T Consensus        23 ww~~~f~-~tivfa~~Y~~~yp~~   45 (51)
T PF14715_consen   23 WWLWLFY-GTIVFAVGYLVLYPGL   45 (51)
T ss_pred             HHHHHHH-HHHHHHHHHHHHHhcc
Confidence            3344443 3467889999999644


No 14 
>TIGR03779 Bac_Flav_CT_M Bacteroides conjugative transposon TraM protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage.
Probab=32.65  E-value=32  Score=30.58  Aligned_cols=19  Identities=26%  Similarity=0.639  Sum_probs=17.0

Q ss_pred             HHhhHHHHHHHHHHHHHhh
Q psy13804         94 IVFPVCFVCFNLMYWIIYL  112 (129)
Q Consensus        94 i~FP~~F~iFNi~YW~~yl  112 (129)
                      ++||++|++|-.+-|++|-
T Consensus         9 lV~~lm~l~flg~~wlIF~   27 (410)
T TIGR03779         9 LVLPLMGLVFLGSLWLIFA   27 (410)
T ss_pred             chHHHHHHHHHHHHHHhcc
Confidence            6899999999999998885


No 15 
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=31.88  E-value=65  Score=20.82  Aligned_cols=16  Identities=31%  Similarity=0.843  Sum_probs=8.8

Q ss_pred             hhHHHHHHHHHHHHHh
Q psy13804         96 FPVCFVCFNLMYWIIY  111 (129)
Q Consensus        96 FP~~F~iFNi~YW~~y  111 (129)
                      |=+||++|.++|...+
T Consensus        15 ~lIC~Fl~~~~~F~~F   30 (54)
T PF06716_consen   15 FLICLFLFCLVVFIWF   30 (54)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3456666766654433


No 16 
>KOG3249|consensus
Probab=30.65  E-value=43  Score=26.75  Aligned_cols=21  Identities=24%  Similarity=0.368  Sum_probs=17.5

Q ss_pred             HHHHHhhHHHHHHHHHHHHHh
Q psy13804         91 YSRIVFPVCFVCFNLMYWIIY  111 (129)
Q Consensus        91 ~SRi~FP~~F~iFNi~YW~~y  111 (129)
                      ..|+-|=++|++|..+||+|+
T Consensus       120 a~~l~fGlvff~lSlf~~iy~  140 (181)
T KOG3249|consen  120 AHRLDFGLVFFLLSLFSIIYL  140 (181)
T ss_pred             HHHHHhhHHHHHHHHHHHhee
Confidence            457778999999999999654


No 17 
>COG4300 CadD Predicted permease, cadmium resistance protein [Inorganic ion transport and metabolism]
Probab=29.60  E-value=43  Score=27.23  Aligned_cols=21  Identities=24%  Similarity=0.532  Sum_probs=17.4

Q ss_pred             chhHHhHHHHHhhHHHHHHHH
Q psy13804         85 PSDIDKYSRIVFPVCFVCFNL  105 (129)
Q Consensus        85 ~~~ID~~SRi~FP~~F~iFNi  105 (129)
                      .+.+.+|||+++|+.|+..-+
T Consensus       168 ~evlEk~sr~i~~~V~I~LGl  188 (205)
T COG4300         168 GEVLEKYSRWIVAFVYIGLGL  188 (205)
T ss_pred             HHHHHHHHHHHHHHHHHHhhh
Confidence            467999999999999877643


No 18 
>KOG3989|consensus
Probab=28.88  E-value=31  Score=28.29  Aligned_cols=31  Identities=23%  Similarity=0.570  Sum_probs=21.0

Q ss_pred             HHhHHH-HHhhHHHHHHHHHHHHHhhhcccccc
Q psy13804         88 IDKYSR-IVFPVCFVCFNLMYWIIYLHISDVVA  119 (129)
Q Consensus        88 ID~~SR-i~FP~~F~iFNi~YW~~yl~~~~~~~  119 (129)
                      -|-.++ +.||+.-++. ++||..|++-.+...
T Consensus        77 ~D~l~~tlafPv~~~V~-~~FW~Ly~~d~~Li~  108 (224)
T KOG3989|consen   77 RDYLAATLAFPVEVIVT-VLFWGLYLYDRELLM  108 (224)
T ss_pred             HHHHHHHHhchHHHhhh-hhhhhheeecHHHcC
Confidence            355555 6778776665 899999986554443


No 19 
>PF12339 DNAJ_related:  DNA-J related protein ;  InterPro: IPR021059  This domain family is approximately 130 amino acids in length and contains a conserved YYLD sequence motif. The proteins have a C-terminal DNA-J domain PF00226 from PFAM and most of the sequences are annotated as DNA-J related proteins, other annotations include: DnaJ-class molecular chaperon and formate dehydrogenase; but there is currently no publications to support these annotations. 
Probab=28.67  E-value=49  Score=24.84  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=14.2

Q ss_pred             HHHhhHHHHHHHHHHHH
Q psy13804         93 RIVFPVCFVCFNLMYWI  109 (129)
Q Consensus        93 Ri~FP~~F~iFNi~YW~  109 (129)
                      ..+|..=|++||.+|=.
T Consensus        46 ~~LFk~hFLl~naLY~L   62 (132)
T PF12339_consen   46 LDLFKRHFLLFNALYQL   62 (132)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46899999999999843


No 20 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=28.14  E-value=50  Score=27.02  Aligned_cols=25  Identities=12%  Similarity=0.285  Sum_probs=17.2

Q ss_pred             hHHHHHhhHHHHHHHHHHHHHhhhcc
Q psy13804         90 KYSRIVFPVCFVCFNLMYWIIYLHIS  115 (129)
Q Consensus        90 ~~SRi~FP~~F~iFNi~YW~~yl~~~  115 (129)
                      +.=.++|=++ +||-|+||++|-...
T Consensus        28 ~ww~~~f~~~-i~~~~~y~~~yp~~~   52 (285)
T TIGR00782        28 RWWLWTFYAT-IVWGFGYLVAYPAWP   52 (285)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHhcccC
Confidence            3444555444 889999999995443


No 21 
>PHA02690 hypothetical protein; Provisional
Probab=23.30  E-value=1e+02  Score=21.90  Aligned_cols=27  Identities=22%  Similarity=0.438  Sum_probs=21.8

Q ss_pred             hHHhHHHHHhhHHHHHHHHHHHHHhhh
Q psy13804         87 DIDKYSRIVFPVCFVCFNLMYWIIYLH  113 (129)
Q Consensus        87 ~ID~~SRi~FP~~F~iFNi~YW~~yl~  113 (129)
                      -+-..-|.+|-++|.+|-++|-+.-+.
T Consensus        37 lLR~~~RlLfDL~lTvfV~myiv~Rl~   63 (90)
T PHA02690         37 LLRQMWRLLFDLLLTVFVVMYIVFRLI   63 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            355778999999999999998766543


No 22 
>PF14393 DUF4422:  Domain of unknown function (DUF4422)
Probab=21.50  E-value=80  Score=25.74  Aligned_cols=26  Identities=15%  Similarity=0.296  Sum_probs=20.6

Q ss_pred             cccCCchhHHhHHHHHhhHHHHHHHH
Q psy13804         80 LYGITPSDIDKYSRIVFPVCFVCFNL  105 (129)
Q Consensus        80 ~~~~~~~~ID~~SRi~FP~~F~iFNi  105 (129)
                      ++...-+..|.||-++|+++|-+-.-
T Consensus       170 MfImkkelF~~Yc~wLF~ILfelek~  195 (231)
T PF14393_consen  170 MFIMKKELFDEYCEWLFDILFELEKR  195 (231)
T ss_pred             eeEcchHHHHHHHHHHHHHHHHHHHh
Confidence            34456678999999999999977544


No 23 
>PF06638 Strabismus:  Strabismus protein;  InterPro: IPR009539 This family consists of several strabismus (STB) or Van Gogh-like (VANGL) proteins 1 and 2. The exact function of this family is unknown. It is thought, however that STB1 gene and STB2 may be potent tumour suppressor gene candidates [].; GO: 0007275 multicellular organismal development, 0016021 integral to membrane
Probab=21.26  E-value=90  Score=28.65  Aligned_cols=22  Identities=27%  Similarity=0.537  Sum_probs=15.1

Q ss_pred             HHHhhHHHHHHHHHHHHHhhhc
Q psy13804         93 RIVFPVCFVCFNLMYWIIYLHI  114 (129)
Q Consensus        93 Ri~FP~~F~iFNi~YW~~yl~~  114 (129)
                      |.+.=++-++|-+.||.+|...
T Consensus       167 Ra~ll~Lvfl~~~syWLFY~vr  188 (505)
T PF06638_consen  167 RALLLVLVFLFLFSYWLFYGVR  188 (505)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhe
Confidence            4444455566778999999643


No 24 
>PF06196 DUF997:  Protein of unknown function (DUF997);  InterPro: IPR010398 This is a family of predicted bacterial membrane protein with unknown function.
Probab=20.88  E-value=1.4e+02  Score=20.51  Aligned_cols=30  Identities=30%  Similarity=0.533  Sum_probs=20.6

Q ss_pred             hHHHHHhhHHHHHHHHHHHHHhhhcccccccc
Q psy13804         90 KYSRIVFPVCFVCFNLMYWIIYLHISDVVADD  121 (129)
Q Consensus        90 ~~SRi~FP~~F~iFNi~YW~~yl~~~~~~~~~  121 (129)
                      -+|-|+.|++|++  ++|+.+-....|+..|+
T Consensus        47 ~~SCi~~~il~~~--l~~~~vk~~Fkd~~Ld~   76 (80)
T PF06196_consen   47 FYSCIGGPILFII--LVWLMVKFFFKDIPLDD   76 (80)
T ss_pred             HHHHHHHHHHHHH--HHHHHHHHHhhcCCCCc
Confidence            5788888888876  45556655666666554


Done!