Diaphorina citri psyllid: psy13810

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
ELSEIAKHYVIRLLFVEQPVPQAVIASWLSKTHAKEHKEATDTLTELRRNAKVALLGGGKPWSMSAKLEVDSKARDLDFLNQYALERWECILRFMVGSQQTEGISADAVRTLFNEGAENPVITKDGFQFLLLETPAQVWYFILKYLETVESKGLDLVECLTFLFQLKFSTFGTDYSTEGMSDKLQVFLQHLREFGLVYQRKRKAGRFYPTKLALNMATRGTLKQIREPGFLIVETNFRVYAYTDSNLKVALIGLFCELMYRFPNLTVGVLTRDSVRAALRSGITAAQIIGFLRLHALPSVSCPLPPVVSDQIRLWEGERERLTTSEGVLYSQFVSQADFEKLRDYAQDLGVLTWQNEKKRTVVVTKQGHSDIKKFWVNHQKGSQHS
cccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccEEEcccccccEECcHHHHHHHHcccccccccccEEEEEEccEEccccccHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccEEEcccEEEcccccHHHHHHHHHHHHHHcEEEEEccccEEEEEEccccHHHHHHHHHHHHccccc
ELSEIAKHYVIRLLFVEQPVPQAVIASWLSKTHA*E****TDTLTELRRNAKVALLGGGKPWSMSAKLEVDSKARDLDFLNQYALERWECILRFMVGSQQTEGISADAVRTLFNEGAENPVITKDGFQFLLLETPAQVWYFILKYLETVESKGLDLVECLTFLFQLKFSTFGTDYSTEGMSDKLQVFLQHLREFGLVYQRKRKAGRFYPTKLALNMATRGTLK**REPGFLIVETNFRVYAYTDSNLKVALIGLFCELMYRFPNLTVGVLTRDSVRAALRSGITAAQIIGFLRLHALPSVSCPLPPVVSDQIRLWEGERERLTTSEGVLYSQFVSQADFEKLRDYAQDLGVLTWQNEKKRTVVVTKQGHSDIKKFWVN********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELSEIAKHYVIRLLFVEQPVPQAVIASWLSKTHAKEHKEATDTLTELRRNAKVALLGGGKPWSMSAKLEVDSKARDLDFLNQYALERWECILRFMVGSQQTEGISADAVRTLFNEGAENPVITKDGFQFLLLETPAQVWYFILKYLETVESKGLDLVECLTFLFQLKFSTFGTDYSTEGMSDKLQVFLQHLREFGLVYQRKRKAGRFYPTKLALNMATRGTLKQIREPGFLIVETNFRVYAYTDSNLKVALIGLFCELMYRFPNLTVGVLTRDSVRAALRSGITAAQIIGFLRLHALPSVSCPLPPVVSDQIRLWEGERERLTTSEGVLYSQFVSQADFEKLRDYAQDLGVLTWQNEKKRTVVVTKQGHSDIKKFWVNHQKGSQHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
General transcription factor IIH subunit 4 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.very confidentP60027
General transcription factor IIH subunit 4 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.very confidentQ92759
General transcription factor IIH subunit 4 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.very confidentO70422

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005675 [CC]holo TFIIH complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0008353 [MF]RNA polymerase II carboxy-terminal domain kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0006283 [BP]transcription-coupled nucleotide-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0000718 [BP]nucleotide-excision repair, DNA damage removalprobableGO:0044238, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0044349, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0051716, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0008150, GO:0008152, GO:0034655, GO:0006289, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0044763
GO:0006370 [BP]7-methylguanosine mRNA cappingprobableGO:0036260, GO:0009452, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0006361 [BP]transcription initiation from RNA polymerase I promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006363 [BP]termination of RNA polymerase I transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0006362 [BP]transcription elongation from RNA polymerase I promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0001671 [MF]ATPase activator activityprobableGO:0003674, GO:0030234, GO:0060589, GO:0008047, GO:0060590
GO:0050434 [BP]positive regulation of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000439 [CC]core TFIIH complexprobableGO:0043234, GO:0032806, GO:0032991, GO:0005575, GO:0005634, GO:0044464, GO:0005623, GO:0043231, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0000441
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DOM, chain A
Confidence level:very confident
Coverage over the Query: 308-380
View the alignment between query and template
View the model in PyMOL