Diaphorina citri psyllid: psy13812


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MKSLSDTVGQLGLYFITVLLGLLIHGFILLPAMYTFFVREWPFRFTANMGQAIATAFGTASRLFIGYNAMQCLEENNKIDPRISRFVMPIGATINMDGTALYEAVAAIFIAQVRFVIPIT
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHHHccccccc
***LSDTVGQLGLYFITVLLGLLIHGFILLPAMYTFFVREWPFRFTANMGQAIATAFGTASRLFIGYNAMQCLEENNKIDPRISRFVMPIGATINMDGTALYEAVAAIFIAQVRFVIPI*
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSLSDTVGQLGLYFITVLLGLLIHGFILLPAMYTFFVREWPFRFTANMGQAIATAFGTASRLFIGYNAMQCLEENNKIDPRISRFVMPIGATINMDGTALYEAVAAIFIAQVRFVIPIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Excitatory amino acid transporter 1 Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.confidentP43003
Putative sodium-dependent excitatory amino acid transporter glt-4 confidentQ22682
Excitatory amino acid transporter 2 Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.confidentP31596

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043200 [BP]response to amino acid stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0001101, GO:0042221, GO:1901698
GO:0030673 [CC]axolemmaprobableGO:0044304, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0033267, GO:0044464, GO:0005886, GO:0042995, GO:0044459, GO:0044425
GO:0003333 [BP]amino acid transmembrane transportprobableGO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0015175 [MF]neutral amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0051938 [BP]L-glutamate importprobableGO:0006810, GO:0043090, GO:0044765, GO:0043092, GO:0015813, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0015807, GO:0015800, GO:0008150, GO:0071702, GO:0006835, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015501 [MF]glutamate:sodium symporter activityprobableGO:0005342, GO:0005343, GO:0003674, GO:0005416, GO:0015081, GO:0008509, GO:0022857, GO:0015370, GO:0005215, GO:0046873, GO:0022804, GO:0015294, GO:0015291, GO:0015293, GO:0005310, GO:0005313, GO:0008324, GO:0046943, GO:0022891, GO:0022890, GO:0022892, GO:0005283, GO:0015075, GO:0008514, GO:0015077, GO:0015179, GO:0015171, GO:0015172
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0015804 [BP]neutral amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0070779 [BP]D-aspartate importprobableGO:0006835, GO:0015810, GO:0043090, GO:0044765, GO:0051234, GO:0015849, GO:0006811, GO:0006865, GO:0070777, GO:0015711, GO:0071705, GO:0006820, GO:0015800, GO:0008150, GO:0006810, GO:0071702, GO:0042940, GO:0015740, GO:0051179, GO:0044699, GO:0046942
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NWL, chain A
Confidence level:very confident
Coverage over the Query: 3-117
View the alignment between query and template
View the model in PyMOL