Query         psy1385
Match_columns 69
No_of_seqs    32 out of 34
Neff          2.4 
Searched_HMMs 46136
Date          Fri Aug 16 22:01:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1385.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1385hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00628 PHD:  PHD-finger;  Int  98.0 8.1E-06 1.8E-10   45.1   2.7   25   43-69      2-26  (51)
  2 smart00249 PHD PHD zinc finger  97.4 7.7E-05 1.7E-09   38.5   1.6   25   43-69      2-26  (47)
  3 PF14446 Prok-RING_1:  Prokaryo  94.7    0.02 4.3E-07   34.9   1.5   29   40-69      5-33  (54)
  4 PF07649 C1_3:  C1-like domain;  92.2   0.092   2E-06   27.1   1.3   27   41-69      1-27  (30)
  5 PF03604 DNA_RNApol_7kD:  DNA d  90.5    0.11 2.3E-06   28.4   0.5   24   41-65      1-25  (32)
  6 PF13639 zf-RING_2:  Ring finge  90.3     0.2 4.3E-06   26.9   1.5   26   42-69      2-27  (44)
  7 smart00659 RPOLCX RNA polymera  90.1    0.19 4.1E-06   28.8   1.4   24   40-64      2-26  (44)
  8 PF03107 C1_2:  C1 domain;  Int  85.4    0.88 1.9E-05   23.6   2.0   26   41-68      1-26  (30)
  9 PF07282 OrfB_Zn_ribbon:  Putat  82.7     1.1 2.5E-05   25.8   2.0   30   39-69     27-58  (69)
 10 PF13240 zinc_ribbon_2:  zinc-r  81.5    0.67 1.4E-05   23.4   0.6   19   43-64      2-20  (23)
 11 KOG3507|consensus               80.7     1.1 2.3E-05   28.4   1.4   29   35-64     15-44  (62)
 12 PF04640 PLATZ:  PLATZ transcri  79.9     1.8 3.8E-05   27.4   2.2   31   32-64     40-71  (72)
 13 PF13832 zf-HC5HC2H_2:  PHD-zin  78.3     1.9   4E-05   26.7   2.0   28   38-68     53-81  (110)
 14 PF04770 ZF-HD_dimer:  ZF-HD pr  77.6     1.3 2.8E-05   27.7   1.1   16   54-69     38-54  (60)
 15 KOG4323|consensus               77.2    0.86 1.9E-05   37.3   0.3   28   41-69    169-197 (464)
 16 PRK00398 rpoP DNA-directed RNA  76.6     1.8 3.8E-05   23.9   1.4   24   40-64      3-28  (46)
 17 PF00130 C1_1:  Phorbol esters/  76.0     4.1 8.8E-05   22.3   2.8   30   39-69     10-40  (53)
 18 PF11793 FANCL_C:  FANCL C-term  75.7     1.4   3E-05   26.6   0.9   29   41-69      3-34  (70)
 19 PF02591 DUF164:  Putative zinc  73.5     2.1 4.6E-05   24.5   1.2   24   42-66     24-55  (56)
 20 PF02085 Cytochrom_CIII:  Class  71.9     1.1 2.3E-05   27.7  -0.3   39   23-64     16-54  (102)
 21 COG1996 RPC10 DNA-directed RNA  66.2     2.9 6.3E-05   25.0   0.8   26   38-64      4-31  (49)
 22 PF09416 UPF1_Zn_bind:  RNA hel  64.5     5.4 0.00012   28.4   2.0   23   42-67      2-24  (152)
 23 TIGR01566 ZF_HD_prot_N ZF-HD h  64.4     3.9 8.4E-05   25.2   1.1   17   53-69     33-50  (53)
 24 cd04476 RPA1_DBD_C RPA1_DBD_C:  63.6     4.5 9.9E-05   26.7   1.4   24   41-65     35-59  (166)
 25 KOG4718|consensus               62.7     1.3 2.9E-05   33.8  -1.4   30   36-69    177-206 (235)
 26 PF05495 zf-CHY:  CHY zinc fing  62.5     5.4 0.00012   24.1   1.5   27   40-67     41-71  (71)
 27 KOG1973|consensus               62.3     4.3 9.3E-05   30.0   1.2   22   45-68    223-246 (274)
 28 smart00451 ZnF_U1 U1-like zinc  61.2     3.7   8E-05   20.6   0.5   11   57-68      4-14  (35)
 29 PF03119 DNA_ligase_ZBD:  NAD-d  60.3     7.1 0.00015   20.3   1.5   21   42-62      1-23  (28)
 30 PF13901 DUF4206:  Domain of un  59.4     6.6 0.00014   27.7   1.7   29   40-69    152-184 (202)
 31 cd07172 NR_DBD_GR_PR DNA-bindi  57.5     3.3 7.1E-05   25.6  -0.1   28   41-69      3-31  (78)
 32 cd07163 NR_DBD_TLX DNA-binding  56.6       9 0.00019   24.3   1.8   29   40-69      6-35  (92)
 33 cd07157 2DBD_NR_DBD1 The first  55.8     6.8 0.00015   24.6   1.1   27   42-69      2-29  (86)
 34 cd06967 NR_DBD_TR2_like DNA-bi  53.8     8.2 0.00018   24.2   1.3   28   41-69      4-32  (87)
 35 cd07173 NR_DBD_AR DNA-binding   53.5     2.6 5.6E-05   26.4  -1.0   30   39-69      2-32  (82)
 36 COG2158 Uncharacterized protei  52.0      14  0.0003   25.7   2.3   30   38-69     40-73  (112)
 37 KOG0957|consensus               51.3     4.5 9.7E-05   34.9  -0.3   28   39-68    543-570 (707)
 38 PRK11088 rrmA 23S rRNA methylt  50.6      12 0.00027   26.3   1.9   25   40-65      2-26  (272)
 39 PF13248 zf-ribbon_3:  zinc-rib  50.1     7.3 0.00016   19.6   0.5   18   42-61      4-21  (26)
 40 PF13894 zf-C2H2_4:  C2H2-type   49.5     7.4 0.00016   17.2   0.4   12   41-52      1-12  (24)
 41 PF13831 PHD_2:  PHD-finger; PD  45.5      11 0.00023   20.5   0.7   15   54-69      2-16  (36)
 42 PF00412 LIM:  LIM domain;  Int  45.2      28  0.0006   18.7   2.4   15   43-57      1-15  (58)
 43 PF03966 Trm112p:  Trm112p-like  44.7      19 0.00042   21.2   1.8   16   51-67     48-63  (68)
 44 cd06965 NR_DBD_Ppar DNA-bindin  43.8       7 0.00015   24.3  -0.2   27   42-69      1-28  (84)
 45 KOG2752|consensus               43.0      11 0.00025   30.2   0.9   41   25-68    114-159 (345)
 46 cd07160 NR_DBD_LXR DNA-binding  43.0      18 0.00039   23.6   1.7   29   40-69     18-47  (101)
 47 PF07191 zinc-ribbons_6:  zinc-  43.0      19 0.00041   22.9   1.7   25   42-67      3-27  (70)
 48 smart00744 RINGv The RING-vari  42.2      10 0.00022   21.6   0.3   24   43-69      2-30  (49)
 49 TIGR00201 comF comF family pro  41.6      11 0.00024   25.6   0.5   22   43-67      1-22  (190)
 50 PF13771 zf-HC5HC2H:  PHD-like   41.2      28 0.00062   20.5   2.2   26   40-68     36-62  (90)
 51 KOG4216|consensus               41.0      10 0.00022   31.6   0.3   30   39-69     45-75  (479)
 52 cd06960 NR_DBD_HNF4A DNA-bindi  40.9      15 0.00033   22.1   1.0   14   55-69     14-27  (76)
 53 PF10571 UPF0547:  Uncharacteri  40.8      13 0.00029   19.2   0.6   21   42-65      2-22  (26)
 54 PRK12411 cytidine deaminase; P  39.8     8.6 0.00019   25.8  -0.2   15   38-52     81-95  (132)
 55 KOG1244|consensus               39.5      20 0.00043   28.8   1.7   25   42-68    283-307 (336)
 56 PF14354 Lar_restr_allev:  Rest  39.2      25 0.00055   19.7   1.7   26   39-65      2-37  (61)
 57 cd06970 NR_DBD_PNR DNA-binding  38.9      17 0.00038   23.1   1.1   31   38-69      4-35  (92)
 58 KOG1632|consensus               38.6     2.6 5.5E-05   32.5  -3.3   28   40-68    239-266 (345)
 59 cd06963 NR_DBD_GR_like The DNA  38.2     9.8 0.00021   23.0  -0.1   26   43-69      1-27  (73)
 60 PRK08298 cytidine deaminase; V  37.4     9.3  0.0002   26.0  -0.4   15   39-53     85-99  (136)
 61 PF00105 zf-C4:  Zinc finger, C  37.4     6.7 0.00015   22.9  -0.9   27   42-69      2-29  (70)
 62 cd06968 NR_DBD_ROR DNA-binding  37.2      10 0.00022   24.3  -0.2   28   41-69      6-34  (95)
 63 PRK06848 hypothetical protein;  36.1      11 0.00023   25.6  -0.2   16   38-53     92-107 (139)
 64 PHA00733 hypothetical protein   35.7      35 0.00076   22.7   2.2   33   36-69     69-111 (128)
 65 PRK12366 replication factor A;  35.1      22 0.00048   29.3   1.4   24   41-65    533-556 (637)
 66 PF08646 Rep_fac-A_C:  Replicat  34.8      25 0.00054   22.8   1.4   23   42-65     20-45  (146)
 67 cd06956 NR_DBD_RXR DNA-binding  34.6     8.2 0.00018   23.6  -0.9   27   42-69      2-29  (77)
 68 PRK11788 tetratricopeptide rep  34.5      32 0.00069   24.0   1.9   28   36-66    350-377 (389)
 69 cd06959 NR_DBD_EcR_like The DN  34.2      11 0.00023   22.7  -0.4   26   43-69      2-28  (73)
 70 cd07169 NR_DBD_GCNF_like DNA-b  34.1     9.9 0.00021   24.1  -0.6   29   40-69      6-35  (90)
 71 KOG2593|consensus               33.3      31 0.00066   28.5   1.9   33   32-65    120-161 (436)
 72 PF12678 zf-rbx1:  RING-H2 zinc  32.6      39 0.00084   20.2   1.8   27   43-69     22-56  (73)
 73 cd07156 NR_DBD_VDR_like The DN  32.5      17 0.00038   21.8   0.3   14   55-69     14-27  (72)
 74 cd07158 NR_DBD_Ppar_like The D  31.4      10 0.00023   22.7  -0.8   14   55-69     14-27  (73)
 75 PF00096 zf-C2H2:  Zinc finger,  31.4      17 0.00038   16.6   0.1   12   41-52      1-12  (23)
 76 smart00746 TRASH metallochaper  31.2      40 0.00088   14.9   1.4   10   43-52      1-10  (39)
 77 smart00399 ZnF_C4 c4 zinc fing  30.9      20 0.00044   21.1   0.4   26   43-69      2-28  (70)
 78 PF13912 zf-C2H2_6:  C2H2-type   30.9      19 0.00042   17.1   0.3   13   40-52      1-13  (27)
 79 KOG4218|consensus               30.2      16 0.00036   30.3  -0.1   27   42-69     17-44  (475)
 80 cd07162 NR_DBD_PXR DNA-binding  30.2      13 0.00028   23.2  -0.6   26   43-69      2-28  (87)
 81 PF12660 zf-TFIIIC:  Putative z  30.2      32 0.00068   22.1   1.2   32   34-66      8-40  (99)
 82 TIGR01384 TFS_arch transcripti  30.1      41 0.00088   20.8   1.7   13   39-51     15-27  (104)
 83 KOG1829|consensus               29.8      11 0.00025   31.7  -1.1   27   40-69    511-543 (580)
 84 KOG0383|consensus               29.6      20 0.00044   30.7   0.3   22   42-68     49-70  (696)
 85 smart00132 LIM Zinc-binding do  29.5      40 0.00086   16.2   1.3   19   42-60      1-19  (39)
 86 COG1579 Zn-ribbon protein, pos  29.0      23  0.0005   26.6   0.5   23   42-65    199-229 (239)
 87 TIGR03831 YgiT_finger YgiT-typ  28.4      34 0.00073   17.7   1.0   15   39-53     31-45  (46)
 88 KOG1802|consensus               28.2      44 0.00094   30.0   2.1   30   37-69     57-86  (935)
 89 COG0295 Cdd Cytidine deaminase  28.0      23  0.0005   24.6   0.3   16   37-52     82-97  (134)
 90 COG5188 PRP9 Splicing factor 3  27.7      19 0.00042   29.9  -0.1   22   47-69    229-250 (470)
 91 PF06220 zf-U1:  U1 zinc finger  27.6      24 0.00052   19.4   0.3    9   58-67      5-13  (38)
 92 PF14421 LmjF365940-deam:  A di  27.0      24 0.00052   26.4   0.3   18   33-50    147-164 (193)
 93 KOG1512|consensus               26.9      29 0.00063   28.2   0.8   25   42-68    316-340 (381)
 94 smart00109 C1 Protein kinase C  26.8      20 0.00043   18.4  -0.1   27   41-68     12-38  (49)
 95 smart00834 CxxC_CXXC_SSSS Puta  26.7      30 0.00064   17.8   0.5   10   41-50      6-15  (41)
 96 cd00350 rubredoxin_like Rubred  26.6      41 0.00089   17.5   1.1   13   41-53      2-14  (33)
 97 PF08209 Sgf11:  Sgf11 (transcr  26.3      29 0.00063   19.0   0.5   16   38-53      2-17  (33)
 98 PRK05578 cytidine deaminase; V  25.5      17 0.00037   24.3  -0.6   15   38-52     81-95  (131)
 99 PF13966 zf-RVT:  zinc-binding   25.4      47   0.001   19.7   1.3   37   30-66     49-86  (86)
100 smart00531 TFIIE Transcription  25.2      37  0.0008   22.6   0.9   14   41-54    124-137 (147)
101 PF07227 DUF1423:  Protein of u  25.0      62  0.0013   26.8   2.3   31   36-68    124-157 (446)
102 PF11331 DUF3133:  Protein of u  25.0      36 0.00077   20.0   0.7   13   38-50     29-41  (46)
103 TIGR01374 soxD sarcosine oxida  24.4      38 0.00082   22.0   0.8    9   60-68     58-66  (84)
104 PF12773 DZR:  Double zinc ribb  23.7      56  0.0012   17.6   1.3   19   40-60     29-47  (50)
105 smart00401 ZnF_GATA zinc finge  22.9      57  0.0012   18.7   1.3   27   40-67      3-35  (52)
106 cd06969 NR_DBD_NGFI-B DNA-bind  22.7      40 0.00087   20.4   0.7   27   42-69      2-29  (75)
107 COG0675 Transposase and inacti  22.5   1E+02  0.0022   20.8   2.7   29   37-69    306-334 (364)
108 cd07155 NR_DBD_ER_like DNA-bin  22.3      15 0.00032   22.3  -1.3   14   55-69     14-27  (75)
109 PHA03256 BDLF3; Provisional     22.3      22 0.00048   23.3  -0.6    7   63-69     25-31  (77)
110 TIGR02098 MJ0042_CXXC MJ0042 f  21.9      84  0.0018   16.2   1.7   24   41-65      3-33  (38)
111 PRK14892 putative transcriptio  21.9      79  0.0017   20.8   2.0   34   35-69     16-54  (99)
112 PF13842 Tnp_zf-ribbon_2:  DDE_  21.3      74  0.0016   16.8   1.5   13   55-68     15-27  (32)
113 PF14634 zf-RING_5:  zinc-RING   21.2      72  0.0016   17.0   1.4   21   42-64      1-21  (44)
114 PF05605 zf-Di19:  Drought indu  21.1      51  0.0011   18.4   0.8   12   40-51     31-42  (54)
115 PF01258 zf-dskA_traR:  Prokary  21.0      24 0.00052   18.6  -0.5   21   43-64      6-31  (36)
116 smart00734 ZnF_Rad18 Rad18-lik  20.8      47   0.001   16.9   0.6   11   41-51      2-12  (26)
117 PRK09710 lar restriction allev  20.5      84  0.0018   19.8   1.8   15   38-52      4-18  (64)
118 cd00029 C1 Protein kinase C co  20.3      55  0.0012   17.0   0.8   26   42-68     13-39  (50)
119 cd06955 NR_DBD_VDR DNA-binding  20.2      48  0.0011   21.8   0.7   28   41-69      7-35  (107)

No 1  
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=97.95  E-value=8.1e-06  Score=45.08  Aligned_cols=25  Identities=44%  Similarity=1.220  Sum_probs=22.6

Q ss_pred             ccccccccccCCceEEecccccceeeC
Q psy1385          43 CGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      |.+|++ ..++++.|.|+. |+.|||.
T Consensus         2 C~vC~~-~~~~~~~i~C~~-C~~~~H~   26 (51)
T PF00628_consen    2 CPVCGQ-SDDDGDMIQCDS-CNRWYHQ   26 (51)
T ss_dssp             BTTTTS-SCTTSSEEEBST-TSCEEET
T ss_pred             CcCCCC-cCCCCCeEEcCC-CChhhCc
Confidence            788998 888899999996 9999995


No 2  
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=94.65  E-value=0.02  Score=34.90  Aligned_cols=29  Identities=34%  Similarity=0.824  Sum_probs=26.8

Q ss_pred             CccccccccccccCCceEEecccccceeeC
Q psy1385          40 IYPCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      -..|-.|++.|.|.||.+.|.. |..=|||
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~-CgapyHR   33 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPE-CGAPYHR   33 (54)
T ss_pred             CccChhhCCcccCCCCEEECCC-CCCcccH
Confidence            3579999999999999999999 9999998


No 4  
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=92.17  E-value=0.092  Score=27.10  Aligned_cols=27  Identities=26%  Similarity=0.709  Sum_probs=10.2

Q ss_pred             ccccccccccccCCceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      +.|..|.+.+.. +-.-.|.. |++.+|.
T Consensus         1 ~~C~~C~~~~~~-~~~Y~C~~-Cdf~lH~   27 (30)
T PF07649_consen    1 FRCDACGKPIDG-GWFYRCSE-CDFDLHE   27 (30)
T ss_dssp             ---TTTS----S---EEE-TT-T-----H
T ss_pred             CcCCcCCCcCCC-CceEECcc-CCCccCh
Confidence            479999999888 78888988 9999983


No 5  
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=90.47  E-value=0.11  Score=28.43  Aligned_cols=24  Identities=38%  Similarity=0.841  Sum_probs=18.5

Q ss_pred             ccccccccccccC-CceEEecccccc
Q psy1385          41 YPCGICHKEVHDN-DQAILCESGCNF   65 (69)
Q Consensus        41 ypCG~C~~eV~D~-ddAI~CE~~C~~   65 (69)
                      |.||.|+.+|... .|+|.|.- |..
T Consensus         1 Y~C~~Cg~~~~~~~~~~irC~~-CG~   25 (32)
T PF03604_consen    1 YICGECGAEVELKPGDPIRCPE-CGH   25 (32)
T ss_dssp             EBESSSSSSE-BSTSSTSSBSS-SS-
T ss_pred             CCCCcCCCeeEcCCCCcEECCc-CCC
Confidence            7899999999984 78899987 653


No 6  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=90.28  E-value=0.2  Score=26.91  Aligned_cols=26  Identities=31%  Similarity=0.791  Sum_probs=21.7

Q ss_pred             cccccccccccCCceEEecccccceeeC
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      .|.||.+++.+++..+...  |.-.||+
T Consensus         2 ~C~IC~~~~~~~~~~~~l~--C~H~fh~   27 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLP--CGHVFHR   27 (44)
T ss_dssp             CETTTTCBHHTTSCEEEET--TSEEEEH
T ss_pred             CCcCCChhhcCCCeEEEcc--CCCeeCH
Confidence            4999999999987777554  9999994


No 7  
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.13  E-value=0.19  Score=28.77  Aligned_cols=24  Identities=33%  Similarity=0.869  Sum_probs=19.9

Q ss_pred             CccccccccccccC-CceEEeccccc
Q psy1385          40 IYPCGICHKEVHDN-DQAILCESGCN   64 (69)
Q Consensus        40 ~ypCG~C~~eV~D~-ddAI~CE~~C~   64 (69)
                      .|.|+.|+.++.-+ .+.|.|-- |.
T Consensus         2 ~Y~C~~Cg~~~~~~~~~~irC~~-CG   26 (44)
T smart00659        2 IYICGECGRENEIKSKDVVRCRE-CG   26 (44)
T ss_pred             EEECCCCCCEeecCCCCceECCC-CC
Confidence            58999999999875 78999975 54


No 8  
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=85.36  E-value=0.88  Score=23.63  Aligned_cols=26  Identities=23%  Similarity=0.701  Sum_probs=21.7

Q ss_pred             ccccccccccccCCceEEecccccceee
Q psy1385          41 YPCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        41 ypCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      |.|++|.+++.... .-.|+. |.+=+|
T Consensus         1 ~~C~~C~~~~~~~~-~Y~C~~-c~f~lh   26 (30)
T PF03107_consen    1 FWCDVCRRKIDGFY-FYHCSE-CCFTLH   26 (30)
T ss_pred             CCCCCCCCCcCCCE-eEEeCC-CCCeEc
Confidence            57999999999877 999966 777666


No 9  
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=82.71  E-value=1.1  Score=25.81  Aligned_cols=30  Identities=20%  Similarity=0.533  Sum_probs=25.8

Q ss_pred             CCcccccccccccc--CCceEEecccccceeeC
Q psy1385          39 PIYPCGICHKEVHD--NDQAILCESGCNFWYHR   69 (69)
Q Consensus        39 ~~ypCG~C~~eV~D--~ddAI~CE~~C~~WFHR   69 (69)
                      +...|..|+..+.+  .+....|.. |.+.+||
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~-Cg~~~~r   58 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPN-CGFEMDR   58 (69)
T ss_pred             CccCccCcccccccccccceEEcCC-CCCEECc
Confidence            45569999999998  788999999 9999987


No 10 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=81.52  E-value=0.67  Score=23.40  Aligned_cols=19  Identities=37%  Similarity=0.975  Sum_probs=15.1

Q ss_pred             ccccccccccCCceEEeccccc
Q psy1385          43 CGICHKEVHDNDQAILCESGCN   64 (69)
Q Consensus        43 CG~C~~eV~D~ddAI~CE~~C~   64 (69)
                      |..|+++|.|  ++.+|.. |.
T Consensus         2 Cp~CG~~~~~--~~~fC~~-CG   20 (23)
T PF13240_consen    2 CPNCGAEIED--DAKFCPN-CG   20 (23)
T ss_pred             CcccCCCCCC--cCcchhh-hC
Confidence            8899999976  6778876 54


No 11 
>KOG3507|consensus
Probab=80.66  E-value=1.1  Score=28.43  Aligned_cols=29  Identities=34%  Similarity=0.679  Sum_probs=22.0

Q ss_pred             CCCCCCcccccccccccc-CCceEEeccccc
Q psy1385          35 PNAPPIYPCGICHKEVHD-NDQAILCESGCN   64 (69)
Q Consensus        35 ~~s~~~ypCG~C~~eV~D-~ddAI~CE~~C~   64 (69)
                      ....-+|.||.|+.|-.= --|+|.|-. |.
T Consensus        15 r~~~miYiCgdC~~en~lk~~D~irCRe-CG   44 (62)
T KOG3507|consen   15 RTATMIYICGDCGQENTLKRGDVIRCRE-CG   44 (62)
T ss_pred             CcccEEEEeccccccccccCCCcEehhh-cc
Confidence            345568999999987543 589999987 64


No 12 
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=79.88  E-value=1.8  Score=27.41  Aligned_cols=31  Identities=26%  Similarity=0.633  Sum_probs=24.4

Q ss_pred             CCCCCCC-CCccccccccccccCCceEEeccccc
Q psy1385          32 PQNPNAP-PIYPCGICHKEVHDNDQAILCESGCN   64 (69)
Q Consensus        32 ~q~~~s~-~~ypCG~C~~eV~D~ddAI~CE~~C~   64 (69)
                      ||+.... ....|-.|++.++|.  .-+|-.+|.
T Consensus        40 pq~~~~~~~~~~C~~C~R~L~d~--~~fCSl~CK   71 (72)
T PF04640_consen   40 PQSRPSKGSGNICETCHRSLQDP--YRFCSLSCK   71 (72)
T ss_pred             CcCCCCCCCCCccCCCCCCCCCC--CeEEeeeEE
Confidence            4554432 478999999999985  899999986


No 13 
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=78.35  E-value=1.9  Score=26.74  Aligned_cols=28  Identities=32%  Similarity=0.720  Sum_probs=23.5

Q ss_pred             CCCccccccccccccCCceEEecc-cccceee
Q psy1385          38 PPIYPCGICHKEVHDNDQAILCES-GCNFWYH   68 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D~ddAI~CE~-~C~~WFH   68 (69)
                      .....|.+|.+.   .---|.|.. +|.++||
T Consensus        53 ~~~~~C~iC~~~---~G~~i~C~~~~C~~~fH   81 (110)
T PF13832_consen   53 RFKLKCSICGKS---GGACIKCSHPGCSTAFH   81 (110)
T ss_pred             hcCCcCcCCCCC---CceeEEcCCCCCCcCCC
Confidence            357899999998   445789987 8999999


No 14 
>PF04770 ZF-HD_dimer:  ZF-HD protein dimerisation region;  InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors. HD-containing proteins are found in diverse organisms such as humans, Drosophila, nematode worms, and plants, where they play important roles in development. Zinc-finger-homeodomain (ZF- HD) subfamily proteins have only been identified in plants, and likely play plant specific roles. ZF-HD proteins are expressed predominantly or exclusively in floral tissue, indicating a likely regulatory role during floral development []. The ZF-HD class of homeodomain proteins may also be involved in the photosynthesis-related mesophyll-specific gene expression of phosphoenolpyruvate carboxylase in C4 species [] and in pathogen signaling and plant defense mechanisms [].  These proteins share three domains of high sequence similarity: the homeodomain (II) located at the carboxy-terminus, and two other segments (Ia and Ib) located in the amino-terminal part. These N-terminal domains contain five conserved cysteine residues and at least three conserved histidine residues whose spacing ressembles zinc-binding domains involved in dimerization of transcription factors. Although the two domains contain at least eight potential zinc-binding amino-acids, the unique spacing of the conserved cysteine and histidine residues within domain Ib suggests that both domains form one rather than two zinc finger structures. The two conserved motifs Ia and Ib constitute a dimerization domain which is sufficient for the formation of homo- and heterodimers [].  This entry represents the N-terminal Cysteine/Histidine-rich dimerization domain. The companion ZF-HD homeobox domain is described in IPR006455 from INTERPRO. 
Probab=77.59  E-value=1.3  Score=27.74  Aligned_cols=16  Identities=38%  Similarity=0.937  Sum_probs=13.8

Q ss_pred             CceEEecc-cccceeeC
Q psy1385          54 DQAILCES-GCNFWYHR   69 (69)
Q Consensus        54 ddAI~CE~-~C~~WFHR   69 (69)
                      .+|+.|.+ ||++=|||
T Consensus        38 ~~al~CaACgCHRnFHR   54 (60)
T PF04770_consen   38 PEALKCAACGCHRNFHR   54 (60)
T ss_pred             cccceecccCcchhccc
Confidence            57888888 89999998


No 15 
>KOG4323|consensus
Probab=77.17  E-value=0.86  Score=37.29  Aligned_cols=28  Identities=25%  Similarity=0.878  Sum_probs=22.2

Q ss_pred             cccccccccccc-CCceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHD-NDQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D-~ddAI~CE~~C~~WFHR   69 (69)
                      ..|-.|..-+-- -..-|+|.. |+.|||+
T Consensus       169 ~qc~vC~~g~~~~~NrmlqC~~-C~~~fHq  197 (464)
T KOG4323|consen  169 LQCSVCYCGGPGAGNRMLQCDK-CRQWYHQ  197 (464)
T ss_pred             ceeeeeecCCcCccceeeeecc-cccHHHH
Confidence            449999865544 359999999 9999995


No 16 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=76.57  E-value=1.8  Score=23.95  Aligned_cols=24  Identities=29%  Similarity=0.776  Sum_probs=17.2

Q ss_pred             CccccccccccccCCc--eEEeccccc
Q psy1385          40 IYPCGICHKEVHDNDQ--AILCESGCN   64 (69)
Q Consensus        40 ~ypCG~C~~eV~D~dd--AI~CE~~C~   64 (69)
                      .|.|..|+.++.-++.  ++.|.- |.
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~-CG   28 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPY-CG   28 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCC-CC
Confidence            5789999988755433  688876 65


No 17 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=75.97  E-value=4.1  Score=22.26  Aligned_cols=30  Identities=23%  Similarity=0.475  Sum_probs=22.7

Q ss_pred             CCcccccccccc-ccCCceEEecccccceeeC
Q psy1385          39 PIYPCGICHKEV-HDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        39 ~~ypCG~C~~eV-~D~ddAI~CE~~C~~WFHR   69 (69)
                      ..-.|..|.+.| ....+++.|+. |+.-.|+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~-C~~~~H~   40 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSW-CGLVCHK   40 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETT-TT-EEET
T ss_pred             CCCCCcccCcccCCCCCCeEEECC-CCChHhh
Confidence            445799999999 33578999998 9999985


No 18 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=75.72  E-value=1.4  Score=26.61  Aligned_cols=29  Identities=28%  Similarity=0.708  Sum_probs=10.6

Q ss_pred             ccccccccccccCC--ceEEec-ccccceeeC
Q psy1385          41 YPCGICHKEVHDND--QAILCE-SGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~d--dAI~CE-~~C~~WFHR   69 (69)
                      -.|+||...+.+++  -.+.|+ ..|..=||+
T Consensus         3 ~~C~IC~~~~~~~~~~p~~~C~n~~C~~~fH~   34 (70)
T PF11793_consen    3 LECGICYSYRLDDGEIPDVVCPNPSCGKKFHL   34 (70)
T ss_dssp             -S-SSS--SS-TT-----B--S-TT----B-S
T ss_pred             CCCCcCCcEecCCCCcCceEcCCcccCCHHHH
Confidence            46999999988544  358897 469988885


No 19 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=73.50  E-value=2.1  Score=24.45  Aligned_cols=24  Identities=29%  Similarity=0.793  Sum_probs=19.7

Q ss_pred             ccccccccccc--------CCceEEecccccce
Q psy1385          42 PCGICHKEVHD--------NDQAILCESGCNFW   66 (69)
Q Consensus        42 pCG~C~~eV~D--------~ddAI~CE~~C~~W   66 (69)
                      .|+-|+..|..        .++-+.|+. |+++
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~-CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPN-CGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcC-CCcc
Confidence            79999987765        478899999 9876


No 20 
>PF02085 Cytochrom_CIII:  Class III cytochrome C family;  InterPro: IPR020942 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes []. Ambler [] recognised four classes of cytC. Class III comprises the low redox potential multiple haem cytochromes: cyt C7 (trihaem), C3 (tetrahaem), and high-molecular-weight cytC, HMC (hexadecahaem), with only 30-40 residues per haem group. The haem c groups, all bis-histidinyl coordinated, are structurally and functionally nonequivalent and present different redox potentials in the range 0 to -400 mV []. The 3D structures of a number of cyt C3 proteins have been determined. The proteins consist of 4-5 alpha-helices and 2 beta-strands wrapped around a compact core of four non-parallel haems, which present a relatively high degree of exposure to the solvent. The overall protein architecture, haem plane orientations and iron-iron distances are highly conserved [].; GO: 0009055 electron carrier activity, 0020037 heme binding; PDB: 1AQE_A 1CZJ_A 1H29_B 1GWS_A 2CVC_A 2KMY_A 1DUW_A 1UPD_A 1I77_A 1GMB_A ....
Probab=71.92  E-value=1.1  Score=27.66  Aligned_cols=39  Identities=18%  Similarity=0.456  Sum_probs=30.2

Q ss_pred             cCCCceeeCCCCCCCCCCccccccccccccCCceEEeccccc
Q psy1385          23 PENQAMVFNPQNPNAPPIYPCGICHKEVHDNDQAILCESGCN   64 (69)
Q Consensus        23 p~~~p~~fn~q~~~s~~~ypCG~C~~eV~D~ddAI~CE~~C~   64 (69)
                      ...+|+.|+-+-..+-.  .|..||..+........|.. |+
T Consensus        16 ~~~~~V~F~H~~H~~~~--~C~~CHh~~~~~~~~~~C~~-CH   54 (102)
T PF02085_consen   16 NTKGPVAFSHSAHADAK--DCSTCHHKSAGGGSIESCMS-CH   54 (102)
T ss_dssp             SSSSEEEEEHHHGTTST--GGGGTSTTCTTTSSSSSCTC-SS
T ss_pred             cCCCCcccChHHHcCCC--ChhhCCCCCcCCCCcchHHH-hc
Confidence            37889999988777443  99999999666667777777 75


No 21 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=66.22  E-value=2.9  Score=24.98  Aligned_cols=26  Identities=31%  Similarity=0.656  Sum_probs=20.8

Q ss_pred             CCCcccccccccccc--CCceEEeccccc
Q psy1385          38 PPIYPCGICHKEVHD--NDQAILCESGCN   64 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D--~ddAI~CE~~C~   64 (69)
                      .-.|-|..|+++|.+  ..+.|.|.- |.
T Consensus         4 ~~~Y~C~~Cg~~~~~~~~~~~irCp~-Cg   31 (49)
T COG1996           4 MMEYKCARCGREVELDQETRGIRCPY-CG   31 (49)
T ss_pred             eEEEEhhhcCCeeehhhccCceeCCC-CC
Confidence            347999999999963  478999986 64


No 22 
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=64.53  E-value=5.4  Score=28.42  Aligned_cols=23  Identities=35%  Similarity=1.143  Sum_probs=15.1

Q ss_pred             cccccccccccCCceEEeccccccee
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWY   67 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WF   67 (69)
                      .|-+|+  ++|-.-.+.|.. |++||
T Consensus         2 aC~YCG--~~~p~~vv~C~~-c~kWF   24 (152)
T PF09416_consen    2 ACAYCG--IHDPSCVVKCNT-CNKWF   24 (152)
T ss_dssp             S-TTT------CCCEEEETT-TTEEE
T ss_pred             CccccC--CCCcccEeEcCC-CCcEe
Confidence            466776  456668899998 99999


No 23 
>TIGR01566 ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich dimerization domain. This model describes a 54-residue domain found in the N-terminal region of plant proteins, the vast majority of which contain a ZF-HD class homeobox domain toward the C-terminus. The region between the two domains typically is rich in low complexity sequence. The companion ZF-HD homeobox domain is described in model TIGR01565.
Probab=64.42  E-value=3.9  Score=25.22  Aligned_cols=17  Identities=29%  Similarity=0.915  Sum_probs=14.2

Q ss_pred             CCceEEecc-cccceeeC
Q psy1385          53 NDQAILCES-GCNFWYHR   69 (69)
Q Consensus        53 ~ddAI~CE~-~C~~WFHR   69 (69)
                      +-+|+.|.+ +|++=|||
T Consensus        33 ~~~al~CaACgCHRnFHR   50 (53)
T TIGR01566        33 DPESLTCAACGCHRNFHR   50 (53)
T ss_pred             CCcceeeeecCccccccc
Confidence            346888888 89999998


No 24 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=63.63  E-value=4.5  Score=26.71  Aligned_cols=24  Identities=33%  Similarity=0.677  Sum_probs=19.1

Q ss_pred             ccccccccccccCC-ceEEecccccc
Q psy1385          41 YPCGICHKEVHDND-QAILCESGCNF   65 (69)
Q Consensus        41 ypCG~C~~eV~D~d-dAI~CE~~C~~   65 (69)
                      .-|..|.+-|.+++ +.-.|+. |+.
T Consensus        35 ~aC~~C~kkv~~~~~~~~~C~~-C~~   59 (166)
T cd04476          35 PACPGCNKKVVEEGNGTYRCEK-CNK   59 (166)
T ss_pred             ccccccCcccEeCCCCcEECCC-CCC
Confidence            35888999998876 8889987 764


No 25 
>KOG4718|consensus
Probab=62.72  E-value=1.3  Score=33.81  Aligned_cols=30  Identities=47%  Similarity=0.855  Sum_probs=25.0

Q ss_pred             CCCCCccccccccccccCCceEEecccccceeeC
Q psy1385          36 NAPPIYPCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        36 ~s~~~ypCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      -++.++.|-+||+.|-   +.|.|++ |+.=|||
T Consensus       177 y~dnlk~Cn~Ch~LvI---qg~rCg~-c~i~~h~  206 (235)
T KOG4718|consen  177 YADNLKNCNLCHCLVI---QGIRCGS-CNIQYHR  206 (235)
T ss_pred             hHHHHHHHhHhHHHhh---eeeccCc-ccchhhh
Confidence            3456889999999997   5799998 9888886


No 26 
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=62.52  E-value=5.4  Score=24.13  Aligned_cols=27  Identities=22%  Similarity=0.707  Sum_probs=12.8

Q ss_pred             CccccccccccccCC----ceEEeccccccee
Q psy1385          40 IYPCGICHKEVHDND----QAILCESGCNFWY   67 (69)
Q Consensus        40 ~ypCG~C~~eV~D~d----dAI~CE~~C~~WF   67 (69)
                      ..-||.|.++..-++    ....|.. |+.||
T Consensus        41 ~v~Cg~C~~~~~~~~~~c~~~~~C~~-C~~~~   71 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEYSCGADYFCPI-CGLYF   71 (71)
T ss_dssp             EEEETTT--EEES-SBTT--SEEETT-TTEEE
T ss_pred             CeECCCCCCccChhhhhcCCCccCcC-cCCCC
Confidence            455666666554433    1345555 66665


No 27 
>KOG1973|consensus
Probab=62.26  E-value=4.3  Score=29.97  Aligned_cols=22  Identities=36%  Similarity=1.007  Sum_probs=17.3

Q ss_pred             ccccccccCCceEEecc-ccc-ceee
Q psy1385          45 ICHKEVHDNDQAILCES-GCN-FWYH   68 (69)
Q Consensus        45 ~C~~eV~D~ddAI~CE~-~C~-~WFH   68 (69)
                      +|.  ...-.+-|.|+. .|. -|||
T Consensus       223 ~Cn--qvsyg~Mi~CDn~~C~~eWFH  246 (274)
T KOG1973|consen  223 ICN--QVSYGKMIGCDNPGCPIEWFH  246 (274)
T ss_pred             Eec--ccccccccccCCCCCCcceEE
Confidence            566  344578999998 799 9999


No 28 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=61.16  E-value=3.7  Score=20.56  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=8.4

Q ss_pred             EEecccccceee
Q psy1385          57 ILCESGCNFWYH   68 (69)
Q Consensus        57 I~CE~~C~~WFH   68 (69)
                      ..|+. |++||.
T Consensus         4 ~~C~~-C~~~~~   14 (35)
T smart00451        4 FYCKL-CNVTFT   14 (35)
T ss_pred             eEccc-cCCccC
Confidence            46888 888875


No 29 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=60.27  E-value=7.1  Score=20.35  Aligned_cols=21  Identities=19%  Similarity=0.642  Sum_probs=12.7

Q ss_pred             cccccccccc--cCCceEEeccc
Q psy1385          42 PCGICHKEVH--DNDQAILCESG   62 (69)
Q Consensus        42 pCG~C~~eV~--D~ddAI~CE~~   62 (69)
                      .|..|+..|.  +++-++.|..+
T Consensus         1 ~CP~C~s~l~~~~~ev~~~C~N~   23 (28)
T PF03119_consen    1 TCPVCGSKLVREEGEVDIRCPNP   23 (28)
T ss_dssp             B-TTT--BEEE-CCTTCEEE--C
T ss_pred             CcCCCCCEeEcCCCCEeEECCCC
Confidence            3889999998  67778999753


No 30 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=59.41  E-value=6.6  Score=27.73  Aligned_cols=29  Identities=24%  Similarity=0.687  Sum_probs=22.3

Q ss_pred             Cccccccccc-ccc---CCceEEecccccceeeC
Q psy1385          40 IYPCGICHKE-VHD---NDQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~e-V~D---~ddAI~CE~~C~~WFHR   69 (69)
                      -|.|-+|+.. |--   .+.++.|+. |..=|||
T Consensus       152 GfiCe~C~~~~~IfPF~~~~~~~C~~-C~~v~H~  184 (202)
T PF13901_consen  152 GFICEICNSDDIIFPFQIDTTVRCPK-CKSVFHK  184 (202)
T ss_pred             CCCCccCCCCCCCCCCCCCCeeeCCc-Cccccch
Confidence            3789999853 322   468999999 9999996


No 31 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=57.46  E-value=3.3  Score=25.59  Aligned_cols=28  Identities=25%  Similarity=0.669  Sum_probs=19.5

Q ss_pred             ccccccccccccC-CceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      -+|-+|+..-... =.++-|++ |...|.|
T Consensus         3 ~~C~VCg~~a~g~hyGv~sC~a-C~~FFRR   31 (78)
T cd07172           3 KICLVCSDEASGCHYGVLTCGS-CKVFFKR   31 (78)
T ss_pred             CCCeecCCcCcceEECceeehh-hHHhHHH
Confidence            4588887654443 45677887 9988876


No 32 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=56.58  E-value=9  Score=24.29  Aligned_cols=29  Identities=21%  Similarity=0.651  Sum_probs=21.3

Q ss_pred             CccccccccccccC-CceEEecccccceeeC
Q psy1385          40 IYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      .-+|-+|+..-+.. =.++-|++ |...|.|
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   35 (92)
T cd07163           6 DIPCKVCGDRSSGKHYGIYACDG-CSGFFKR   35 (92)
T ss_pred             CCCCcccCCcCcccEECceeeee-eeeEEee
Confidence            45788998755553 45677888 9999987


No 33 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=55.82  E-value=6.8  Score=24.57  Aligned_cols=27  Identities=26%  Similarity=0.753  Sum_probs=18.8

Q ss_pred             cccccccccccC-CceEEecccccceeeC
Q psy1385          42 PCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      +|-+|+..-... =.++.|++ |...|.|
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   29 (86)
T cd07157           2 TCQVCGEPAAGFHHGAYVCEA-CKKFFMR   29 (86)
T ss_pred             CCcccCCcCcccEECcceeeE-eeeEEec
Confidence            477787654442 35677888 9999987


No 34 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=53.83  E-value=8.2  Score=24.24  Aligned_cols=28  Identities=25%  Similarity=0.650  Sum_probs=19.7

Q ss_pred             ccccccccccccC-CceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      -+|-+|+..-..- -.++.|++ |...|.|
T Consensus         4 ~~C~VCg~~~~g~hyGv~sC~a-C~~FFRR   32 (87)
T cd06967           4 ELCVVCGDKASGRHYGAVSCEG-CKGFFKR   32 (87)
T ss_pred             CCCeecCCcCCcCEeCcceEee-eeeEeee
Confidence            3588887644443 45667887 9999987


No 35 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=53.52  E-value=2.6  Score=26.41  Aligned_cols=30  Identities=33%  Similarity=0.740  Sum_probs=20.3

Q ss_pred             CCccccccccccccC-CceEEecccccceeeC
Q psy1385          39 PIYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        39 ~~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      +.-+|-+|+..-... =.++-|++ |...|.|
T Consensus         2 ~~~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   32 (82)
T cd07173           2 PQKTCLICGDEASGCHYGALTCGS-CKVFFKR   32 (82)
T ss_pred             CCCCCeecCCcCcceEECcchhhh-HHHHHHH
Confidence            344688898655553 45666777 9888875


No 36 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=52.00  E-value=14  Score=25.66  Aligned_cols=30  Identities=33%  Similarity=0.855  Sum_probs=22.0

Q ss_pred             CCCccccccccc--cccCCc--eEEecccccceeeC
Q psy1385          38 PPIYPCGICHKE--VHDNDQ--AILCESGCNFWYHR   69 (69)
Q Consensus        38 ~~~ypCG~C~~e--V~D~dd--AI~CE~~C~~WFHR   69 (69)
                      .|.|||..|..-  |.|.+-  .--|-- | .|.||
T Consensus        40 CPfYpc~~~~~gewi~~~~G~~VwSC~d-C-~~iH~   73 (112)
T COG2158          40 CPFYPCENEELGEWISDSNGRKVWSCSD-C-HWIHR   73 (112)
T ss_pred             cccccccccccCceeEcCCCCEEeeccc-c-ceecc
Confidence            578999999776  777655  666766 6 48886


No 37 
>KOG0957|consensus
Probab=51.26  E-value=4.5  Score=34.87  Aligned_cols=28  Identities=39%  Similarity=1.005  Sum_probs=23.6

Q ss_pred             CCccccccccccccCCceEEecccccceee
Q psy1385          39 PIYPCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        39 ~~ypCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      ..|.||||.+. +|-+--++|.. |+.-||
T Consensus       543 ~~ysCgiCkks-~dQHll~~CDt-C~lhYH  570 (707)
T KOG0957|consen  543 MNYSCGICKKS-TDQHLLTQCDT-CHLHYH  570 (707)
T ss_pred             cceeeeeeccc-hhhHHHhhcch-hhceee
Confidence            47999999774 56677889999 999998


No 38 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=50.59  E-value=12  Score=26.31  Aligned_cols=25  Identities=20%  Similarity=0.652  Sum_probs=21.0

Q ss_pred             CccccccccccccCCceEEecccccc
Q psy1385          40 IYPCGICHKEVHDNDQAILCESGCNF   65 (69)
Q Consensus        40 ~ypCG~C~~eV~D~ddAI~CE~~C~~   65 (69)
                      +|.|.+|++...-++....|+. .+.
T Consensus         2 ~~~CP~C~~~l~~~~~~~~C~~-~h~   26 (272)
T PRK11088          2 SYQCPLCHQPLTLEENSWICPQ-NHQ   26 (272)
T ss_pred             cccCCCCCcchhcCCCEEEcCC-CCC
Confidence            4889999999987888999998 443


No 39 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=50.11  E-value=7.3  Score=19.58  Aligned_cols=18  Identities=28%  Similarity=0.639  Sum_probs=13.0

Q ss_pred             cccccccccccCCceEEecc
Q psy1385          42 PCGICHKEVHDNDQAILCES   61 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~   61 (69)
                      .|..|++++.+  ++-+|..
T Consensus         4 ~Cp~Cg~~~~~--~~~fC~~   21 (26)
T PF13248_consen    4 FCPNCGAEIDP--DAKFCPN   21 (26)
T ss_pred             CCcccCCcCCc--ccccChh
Confidence            58899996654  6667765


No 40 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=49.54  E-value=7.4  Score=17.22  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=7.3

Q ss_pred             cccccccccccc
Q psy1385          41 YPCGICHKEVHD   52 (69)
Q Consensus        41 ypCG~C~~eV~D   52 (69)
                      |.|.+|.+...+
T Consensus         1 ~~C~~C~~~~~~   12 (24)
T PF13894_consen    1 FQCPICGKSFRS   12 (24)
T ss_dssp             EE-SSTS-EESS
T ss_pred             CCCcCCCCcCCc
Confidence            678888877655


No 41 
>PF13831 PHD_2:  PHD-finger; PDB: 2L43_A 2KU3_A.
Probab=45.52  E-value=11  Score=20.55  Aligned_cols=15  Identities=27%  Similarity=0.864  Sum_probs=7.6

Q ss_pred             CceEEecccccceeeC
Q psy1385          54 DQAILCESGCNFWYHR   69 (69)
Q Consensus        54 ddAI~CE~~C~~WFHR   69 (69)
                      ++-|.|.. |+..+|+
T Consensus         2 n~ll~C~~-C~v~VH~   16 (36)
T PF13831_consen    2 NPLLFCDN-CNVAVHQ   16 (36)
T ss_dssp             CEEEE-SS-S--EEEH
T ss_pred             CceEEeCC-CCCcCCh
Confidence            35567765 7777774


No 42 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=45.20  E-value=28  Score=18.70  Aligned_cols=15  Identities=27%  Similarity=0.640  Sum_probs=9.1

Q ss_pred             ccccccccccCCceE
Q psy1385          43 CGICHKEVHDNDQAI   57 (69)
Q Consensus        43 CG~C~~eV~D~ddAI   57 (69)
                      |..|++.|.+++..|
T Consensus         1 C~~C~~~I~~~~~~~   15 (58)
T PF00412_consen    1 CARCGKPIYGTEIVI   15 (58)
T ss_dssp             BTTTSSBESSSSEEE
T ss_pred             CCCCCCCccCcEEEE
Confidence            566777777655443


No 43 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=44.68  E-value=19  Score=21.16  Aligned_cols=16  Identities=19%  Similarity=0.524  Sum_probs=13.0

Q ss_pred             ccCCceEEeccccccee
Q psy1385          51 HDNDQAILCESGCNFWY   67 (69)
Q Consensus        51 ~D~ddAI~CE~~C~~WF   67 (69)
                      +-.+..+.|.. |++||
T Consensus        48 ~i~eg~L~Cp~-c~r~Y   63 (68)
T PF03966_consen   48 EIVEGELICPE-CGREY   63 (68)
T ss_dssp             ETTTTEEEETT-TTEEE
T ss_pred             cccCCEEEcCC-CCCEE
Confidence            34578899988 99998


No 44 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=43.80  E-value=7  Score=24.33  Aligned_cols=27  Identities=22%  Similarity=0.634  Sum_probs=15.8

Q ss_pred             cccccccccccC-CceEEecccccceeeC
Q psy1385          42 PCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      +|-+|+..-+.. -.++.|++ |...|.|
T Consensus         1 ~C~VCg~~~~g~hyGv~sC~a-Ck~FFRR   28 (84)
T cd06965           1 ECRVCGDKASGFHYGVHACEG-CKGFFRR   28 (84)
T ss_pred             CCcccCccCcceEEChhhhhh-hhhheee
Confidence            356665433332 34566776 8887765


No 45 
>KOG2752|consensus
Probab=43.02  E-value=11  Score=30.22  Aligned_cols=41  Identities=22%  Similarity=0.472  Sum_probs=32.2

Q ss_pred             CCceeeCCCCCCCCCCcccccccccccc-----CCceEEecccccceee
Q psy1385          25 NQAMVFNPQNPNAPPIYPCGICHKEVHD-----NDQAILCESGCNFWYH   68 (69)
Q Consensus        25 ~~p~~fn~q~~~s~~~ypCG~C~~eV~D-----~ddAI~CE~~C~~WFH   68 (69)
                      +++-+.|.-|.+..+.|.  +|.....|     +..-++|.. |--|||
T Consensus       114 ~~~n~~N~YNhNfqG~~C--~Cd~~Ypdp~~~~e~~m~QC~i-CEDWFH  159 (345)
T KOG2752|consen  114 DAENSENLYNHNFQGLFC--KCDTPYPDPVRTEEGEMLQCVI-CEDWFH  159 (345)
T ss_pred             ccccchhhhhhhhcceeE--EecCCCCCccccccceeeeEEe-ccchhc
Confidence            455677788888888884  89988888     345678888 888999


No 46 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=43.02  E-value=18  Score=23.56  Aligned_cols=29  Identities=21%  Similarity=0.595  Sum_probs=20.9

Q ss_pred             CccccccccccccC-CceEEecccccceeeC
Q psy1385          40 IYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      .-+|-+|+..-..- =.++.|++ |...|.|
T Consensus        18 ~~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   47 (101)
T cd07160          18 NEVCSVCGDKASGFHYNVLSCEG-CKGFFRR   47 (101)
T ss_pred             CCCCeecCCcCcceEECcceehh-hhhhhhh
Confidence            44699998755543 35667887 9999987


No 47 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=42.96  E-value=19  Score=22.86  Aligned_cols=25  Identities=28%  Similarity=0.624  Sum_probs=14.5

Q ss_pred             cccccccccccCCceEEeccccccee
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWY   67 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WF   67 (69)
                      .|..|+.++.-+.....|+. |+.=|
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~-C~~~~   27 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEA-CQKDY   27 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETT-T--EE
T ss_pred             cCCCCCCccEEeCCEEECcc-ccccc
Confidence            47777777666667777777 76544


No 48 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=42.20  E-value=10  Score=21.55  Aligned_cols=24  Identities=33%  Similarity=0.786  Sum_probs=13.1

Q ss_pred             ccccccccccCCceEEeccccc-----ceeeC
Q psy1385          43 CGICHKEVHDNDQAILCESGCN-----FWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~ddAI~CE~~C~-----~WFHR   69 (69)
                      |-||.. ..++++.+  ...|.     .|+|+
T Consensus         2 CrIC~~-~~~~~~~l--~~PC~C~G~~~~vH~   30 (49)
T smart00744        2 CRICHD-EGDEGDPL--VSPCRCKGSLKYVHQ   30 (49)
T ss_pred             ccCCCC-CCCCCCee--EeccccCCchhHHHH
Confidence            778877 22233333  34453     78884


No 49 
>TIGR00201 comF comF family protein. This protein is found in species that do (Bacillus subtilis, Haemophilus influenzae) or do not (E. coli, Borrelia burgdorferi) have described systems for natural transformation with exogenous DNA. It is involved in competence for transformation in Bacillus subtilis.
Probab=41.59  E-value=11  Score=25.55  Aligned_cols=22  Identities=27%  Similarity=0.930  Sum_probs=13.4

Q ss_pred             ccccccccccCCceEEeccccccee
Q psy1385          43 CGICHKEVHDNDQAILCESGCNFWY   67 (69)
Q Consensus        43 CG~C~~eV~D~ddAI~CE~~C~~WF   67 (69)
                      |..|++++...  ..+|+. |..|+
T Consensus         1 C~~C~~~~~~~--~~~C~~-C~~~~   22 (190)
T TIGR00201         1 CSLCGRPYQSV--HALCRQ-CGSWR   22 (190)
T ss_pred             CCccccccccc--cCCchh-hCCcc
Confidence            66677766542  356777 76653


No 50 
>PF13771 zf-HC5HC2H:  PHD-like zinc-binding domain
Probab=41.17  E-value=28  Score=20.50  Aligned_cols=26  Identities=35%  Similarity=0.835  Sum_probs=21.5

Q ss_pred             CccccccccccccCCceEEecc-cccceee
Q psy1385          40 IYPCGICHKEVHDNDQAILCES-GCNFWYH   68 (69)
Q Consensus        40 ~ypCG~C~~eV~D~ddAI~CE~-~C~~WFH   68 (69)
                      ...|-+|.+.   .--.|.|.. +|...||
T Consensus        36 ~~~C~~C~~~---~Ga~i~C~~~~C~~~fH   62 (90)
T PF13771_consen   36 KLKCSICKKK---GGACIGCSHPGCSRSFH   62 (90)
T ss_pred             CCCCcCCCCC---CCeEEEEeCCCCCcEEC
Confidence            4689999866   357899987 8999999


No 51 
>KOG4216|consensus
Probab=40.96  E-value=10  Score=31.61  Aligned_cols=30  Identities=33%  Similarity=0.759  Sum_probs=21.8

Q ss_pred             CCccccccccccccC-CceEEecccccceeeC
Q psy1385          39 PIYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        39 ~~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      .+.||-+|+---.-- =-.|-||+ |.-+|-|
T Consensus        45 EvIPCKiCGDKSSGiHYGVITCEG-CKGFFRR   75 (479)
T KOG4216|consen   45 EIIPCKICGDKSSGIHYGVITCEG-CKGFFRR   75 (479)
T ss_pred             EEEeeeeccCCCCcceeeeEeecc-chHhhhh
Confidence            478999997432221 26799999 9999876


No 52 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=40.94  E-value=15  Score=22.13  Aligned_cols=14  Identities=21%  Similarity=0.802  Sum_probs=9.7

Q ss_pred             ceEEecccccceeeC
Q psy1385          55 QAILCESGCNFWYHR   69 (69)
Q Consensus        55 dAI~CE~~C~~WFHR   69 (69)
                      .++.|++ |...|.|
T Consensus        14 gv~~C~a-C~~FFrR   27 (76)
T cd06960          14 GVLSCNG-CKGFFRR   27 (76)
T ss_pred             Ccceeee-ehheeCc
Confidence            4566777 8887766


No 53 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=40.78  E-value=13  Score=19.21  Aligned_cols=21  Identities=33%  Similarity=0.887  Sum_probs=16.1

Q ss_pred             cccccccccccCCceEEecccccc
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNF   65 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~   65 (69)
                      .|..|.++|..  .+..|.. |..
T Consensus         2 ~CP~C~~~V~~--~~~~Cp~-CG~   22 (26)
T PF10571_consen    2 TCPECGAEVPE--SAKFCPH-CGY   22 (26)
T ss_pred             cCCCCcCCchh--hcCcCCC-CCC
Confidence            48899999966  7778876 654


No 54 
>PRK12411 cytidine deaminase; Provisional
Probab=39.83  E-value=8.6  Score=25.83  Aligned_cols=15  Identities=33%  Similarity=1.012  Sum_probs=12.5

Q ss_pred             CCCcccccccccccc
Q psy1385          38 PPIYPCGICHKEVHD   52 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D   52 (69)
                      ....|||.|.+-+.+
T Consensus        81 ~~~sPCG~CRQ~l~E   95 (132)
T PRK12411         81 RPVPPCGACRQVMVE   95 (132)
T ss_pred             CCcCCchhHHHHHHH
Confidence            457899999998877


No 55 
>KOG1244|consensus
Probab=39.49  E-value=20  Score=28.76  Aligned_cols=25  Identities=40%  Similarity=0.975  Sum_probs=20.3

Q ss_pred             cccccccccccCCceEEecccccceee
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      .|-||+..-+| ||-++|.- |++=||
T Consensus       283 ~csicgtsend-dqllfcdd-cdrgyh  307 (336)
T KOG1244|consen  283 YCSICGTSEND-DQLLFCDD-CDRGYH  307 (336)
T ss_pred             eeccccCcCCC-ceeEeecc-cCCcee
Confidence            47788876555 78899999 999988


No 56 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=39.21  E-value=25  Score=19.70  Aligned_cols=26  Identities=19%  Similarity=0.516  Sum_probs=17.2

Q ss_pred             CCcccccccccccc---C-----C--ceEEecccccc
Q psy1385          39 PIYPCGICHKEVHD---N-----D--QAILCESGCNF   65 (69)
Q Consensus        39 ~~ypCG~C~~eV~D---~-----d--dAI~CE~~C~~   65 (69)
                      .+.||..|+....-   +     +  -.|.|.. |..
T Consensus         2 ~LkPCPFCG~~~~~~~~~~~~~~~~~~~V~C~~-Cga   37 (61)
T PF14354_consen    2 ELKPCPFCGSADVLIRQDEGFDYGMYYYVECTD-CGA   37 (61)
T ss_pred             CCcCCCCCCCcceEeecccCCCCCCEEEEEcCC-CCC
Confidence            46889999854332   1     1  4688988 865


No 57 
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=38.92  E-value=17  Score=23.14  Aligned_cols=31  Identities=19%  Similarity=0.551  Sum_probs=22.0

Q ss_pred             CCCccccccccccccC-CceEEecccccceeeC
Q psy1385          38 PPIYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      ++.-+|-+|+..-+.. -.++-|++ |...|.|
T Consensus         4 ~p~~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   35 (92)
T cd06970           4 NPGLLCRVCGDTSSGKHYGIYACNG-CSGFFKR   35 (92)
T ss_pred             CCCCCCeecCCcCcccEECccEEee-eeeEeee
Confidence            3444699998765554 34666887 9999987


No 58 
>KOG1632|consensus
Probab=38.55  E-value=2.6  Score=32.52  Aligned_cols=28  Identities=25%  Similarity=0.705  Sum_probs=23.6

Q ss_pred             CccccccccccccCCceEEecccccceee
Q psy1385          40 IYPCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        40 ~ypCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      -+.|+.|+....-+...|.|.. |..|||
T Consensus       239 ~~~~~~cg~~~~~~~~~~~~~~-~e~w~~  266 (345)
T KOG1632|consen  239 KLICDPCGLSDANKKFEICCDL-CESWFH  266 (345)
T ss_pred             cccccccCcchHHHHHHHHHHH-HHHHhc
Confidence            4789999976555588899999 999999


No 59 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=38.24  E-value=9.8  Score=23.05  Aligned_cols=26  Identities=31%  Similarity=0.777  Sum_probs=14.4

Q ss_pred             ccccccccccC-CceEEecccccceeeC
Q psy1385          43 CGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      |-+|+..-... -.++-|++ |...|.|
T Consensus         1 C~VCg~~a~~~hygv~sC~a-Ck~FFRR   27 (73)
T cd06963           1 CLICGDEASGCHYGVLTCGS-CKVFFKR   27 (73)
T ss_pred             CcccCccCcceEECceeehh-hhHhHHH
Confidence            34454433332 34566777 8877765


No 60 
>PRK08298 cytidine deaminase; Validated
Probab=37.40  E-value=9.3  Score=26.03  Aligned_cols=15  Identities=27%  Similarity=0.833  Sum_probs=12.2

Q ss_pred             CCccccccccccccC
Q psy1385          39 PIYPCGICHKEVHDN   53 (69)
Q Consensus        39 ~~ypCG~C~~eV~D~   53 (69)
                      ...|||.|.+-+.+-
T Consensus        85 ~~sPCG~CRQvl~Ef   99 (136)
T PRK08298         85 VLSPCGVCQERLFYW   99 (136)
T ss_pred             ccCCChhHHHHHHHh
Confidence            478999999877764


No 61 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=37.35  E-value=6.7  Score=22.90  Aligned_cols=27  Identities=19%  Similarity=0.773  Sum_probs=18.2

Q ss_pred             ccccccccccc-CCceEEecccccceeeC
Q psy1385          42 PCGICHKEVHD-NDQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D-~ddAI~CE~~C~~WFHR   69 (69)
                      .|-+|...-.. .-.++-|++ |..+|-|
T Consensus         2 ~C~VCg~~~~~~~ygv~sC~~-C~~FFrR   29 (70)
T PF00105_consen    2 KCKVCGDPASGYHYGVLSCNA-CKMFFRR   29 (70)
T ss_dssp             BSTTTSSBESEEETTEEEEHH-HHHHHHH
T ss_pred             CCeECCCccCccccccccccc-ceeeeee
Confidence            47788765443 346677887 8888754


No 62 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=37.20  E-value=10  Score=24.28  Aligned_cols=28  Identities=32%  Similarity=0.771  Sum_probs=19.1

Q ss_pred             ccccccccccccC-CceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      -+|-+|+..-..- -.++.|++ |...|.|
T Consensus         6 ~~C~VCg~~~~g~hyGv~sC~a-C~~FFRR   34 (95)
T cd06968           6 IPCKICGDKSSGIHYGVITCEG-CKGFFRR   34 (95)
T ss_pred             cCCcccCCcCcceEECceeehh-hHHhhHH
Confidence            4788887644332 34667887 9888876


No 63 
>PRK06848 hypothetical protein; Validated
Probab=36.07  E-value=11  Score=25.62  Aligned_cols=16  Identities=31%  Similarity=0.750  Sum_probs=13.0

Q ss_pred             CCCccccccccccccC
Q psy1385          38 PPIYPCGICHKEVHDN   53 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D~   53 (69)
                      ....|||.|.+-+.+-
T Consensus        92 ~~~~PCG~CRQvl~E~  107 (139)
T PRK06848         92 WVVSPCGACRELISDY  107 (139)
T ss_pred             CccCCChhhHHHHHHh
Confidence            4688999999888763


No 64 
>PHA00733 hypothetical protein
Probab=35.73  E-value=35  Score=22.67  Aligned_cols=33  Identities=18%  Similarity=0.525  Sum_probs=23.0

Q ss_pred             CCCCCccccccccccccC----------CceEEecccccceeeC
Q psy1385          36 NAPPIYPCGICHKEVHDN----------DQAILCESGCNFWYHR   69 (69)
Q Consensus        36 ~s~~~ypCG~C~~eV~D~----------ddAI~CE~~C~~WFHR   69 (69)
                      .+...|.|..|.+.....          .....|+. |.+||-+
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~-CgK~F~~  111 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPV-CGKEFRN  111 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCC-CCCccCC
Confidence            345579999999875541          23458888 9999853


No 65 
>PRK12366 replication factor A; Reviewed
Probab=35.06  E-value=22  Score=29.28  Aligned_cols=24  Identities=38%  Similarity=0.815  Sum_probs=20.2

Q ss_pred             ccccccccccccCCceEEecccccc
Q psy1385          41 YPCGICHKEVHDNDQAILCESGCNF   65 (69)
Q Consensus        41 ypCG~C~~eV~D~ddAI~CE~~C~~   65 (69)
                      .-|..|.+-|.+++..-.||. |+.
T Consensus       533 ~aCp~CnkKv~~~~g~~~C~~-c~~  556 (637)
T PRK12366        533 YLCPNCRKRVEEVDGEYICEF-CGE  556 (637)
T ss_pred             ecccccCeEeEcCCCcEECCC-CCC
Confidence            468899999998778889999 864


No 66 
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=34.81  E-value=25  Score=22.77  Aligned_cols=23  Identities=43%  Similarity=0.925  Sum_probs=14.1

Q ss_pred             ccc--ccccccccC-CceEEecccccc
Q psy1385          42 PCG--ICHKEVHDN-DQAILCESGCNF   65 (69)
Q Consensus        42 pCG--~C~~eV~D~-ddAI~CE~~C~~   65 (69)
                      -|.  .|.+-|..+ +..-.|+. |+.
T Consensus        20 aC~~~~C~kKv~~~~~~~y~C~~-C~~   45 (146)
T PF08646_consen   20 ACPNEKCNKKVTENGDGSYRCEK-CNK   45 (146)
T ss_dssp             E-TSTTTS-B-EEETTTEEEETT-TTE
T ss_pred             CCCCccCCCEeecCCCcEEECCC-CCC
Confidence            366  788887776 45778877 764


No 67 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=34.64  E-value=8.2  Score=23.56  Aligned_cols=27  Identities=26%  Similarity=0.683  Sum_probs=17.2

Q ss_pred             cccccccccccC-CceEEecccccceeeC
Q psy1385          42 PCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      +|-+|+..-..- -.++-|++ |...|.|
T Consensus         2 ~C~VC~~~~~g~hygv~sC~a-C~~FFRR   29 (77)
T cd06956           2 ICAICGDRASGKHYGVYSCEG-CKGFFKR   29 (77)
T ss_pred             CCcccCCcCcceEECceeehh-HHHHHHH
Confidence            477777544443 34566777 8887765


No 68 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=34.50  E-value=32  Score=24.01  Aligned_cols=28  Identities=29%  Similarity=0.675  Sum_probs=21.2

Q ss_pred             CCCCCccccccccccccCCceEEecccccce
Q psy1385          36 NAPPIYPCGICHKEVHDNDQAILCESGCNFW   66 (69)
Q Consensus        36 ~s~~~ypCG~C~~eV~D~ddAI~CE~~C~~W   66 (69)
                      ...+.|-|..|+.-...  =.-.|+. |..|
T Consensus       350 ~~~p~~~c~~cg~~~~~--~~~~c~~-c~~~  377 (389)
T PRK11788        350 KRKPRYRCRNCGFTART--LYWHCPS-CKAW  377 (389)
T ss_pred             hCCCCEECCCCCCCCcc--ceeECcC-CCCc
Confidence            45567889999876655  5567888 9988


No 69 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=34.24  E-value=11  Score=22.73  Aligned_cols=26  Identities=23%  Similarity=0.687  Sum_probs=15.3

Q ss_pred             ccccccccccC-CceEEecccccceeeC
Q psy1385          43 CGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      |-+|+..-... -.++.|++ |...|.|
T Consensus         2 C~vCg~~~~~~hygv~sC~a-C~~FFRR   28 (73)
T cd06959           2 CVVCGDKASGFHYGVLSCEG-CKGFFRR   28 (73)
T ss_pred             CceeCCcCcceEECceeehh-hHHHHHH
Confidence            55565443332 34566777 8888765


No 70 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=34.08  E-value=9.9  Score=24.07  Aligned_cols=29  Identities=28%  Similarity=0.567  Sum_probs=19.6

Q ss_pred             CccccccccccccC-CceEEecccccceeeC
Q psy1385          40 IYPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      .-+|-+|...-... =.++.|++ |...|.|
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   35 (90)
T cd07169           6 QRTCLICGDRATGLHYGIISCEG-CKGFFKR   35 (90)
T ss_pred             CCCCeecCCcCcceEECcceehh-hHHHHHH
Confidence            34588887654443 45677887 9888876


No 71 
>KOG2593|consensus
Probab=33.34  E-value=31  Score=28.49  Aligned_cols=33  Identities=21%  Similarity=0.465  Sum_probs=25.1

Q ss_pred             CCCCCCCCCcccccccccccc---------CCceEEecccccc
Q psy1385          32 PQNPNAPPIYPCGICHKEVHD---------NDQAILCESGCNF   65 (69)
Q Consensus        32 ~q~~~s~~~ypCG~C~~eV~D---------~ddAI~CE~~C~~   65 (69)
                      .++......|-|++|.+...+         .+....|+- |+.
T Consensus       120 ~~d~t~~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~-C~g  161 (436)
T KOG2593|consen  120 LRDDTNVAGYVCPNCQKKYTSLEALQLLDNETGEFHCEN-CGG  161 (436)
T ss_pred             hhhccccccccCCccccchhhhHHHHhhcccCceEEEec-CCC
Confidence            355667788999999998655         367888988 863


No 72 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=32.64  E-value=39  Score=20.23  Aligned_cols=27  Identities=26%  Similarity=0.671  Sum_probs=18.7

Q ss_pred             ccccccccccC--------CceEEecccccceeeC
Q psy1385          43 CGICHKEVHDN--------DQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~--------ddAI~CE~~C~~WFHR   69 (69)
                      |+||.+++.|.        ++...--+.|+=-||+
T Consensus        22 C~IC~~~l~~~~~~~~~~~~~~~i~~~~C~H~FH~   56 (73)
T PF12678_consen   22 CAICREPLEDPCPECQAPQDECPIVWGPCGHIFHF   56 (73)
T ss_dssp             ETTTTSBTTSTTCCHHHCTTTS-EEEETTSEEEEH
T ss_pred             ccccChhhhChhhhhcCCccccceEecccCCCEEH
Confidence            99999999663        2344444568888884


No 73 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=32.48  E-value=17  Score=21.76  Aligned_cols=14  Identities=36%  Similarity=0.973  Sum_probs=9.1

Q ss_pred             ceEEecccccceeeC
Q psy1385          55 QAILCESGCNFWYHR   69 (69)
Q Consensus        55 dAI~CE~~C~~WFHR   69 (69)
                      .++-|++ |...|.|
T Consensus        14 gv~sC~a-C~~FFRR   27 (72)
T cd07156          14 NAMTCEG-CKGFFRR   27 (72)
T ss_pred             Ccceehh-hhhhhch
Confidence            4555666 7777765


No 74 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=31.40  E-value=10  Score=22.66  Aligned_cols=14  Identities=29%  Similarity=0.748  Sum_probs=9.0

Q ss_pred             ceEEecccccceeeC
Q psy1385          55 QAILCESGCNFWYHR   69 (69)
Q Consensus        55 dAI~CE~~C~~WFHR   69 (69)
                      .++.|++ |...|.|
T Consensus        14 Gv~~C~a-C~~FFRR   27 (73)
T cd07158          14 GVHSCEG-CKGFFRR   27 (73)
T ss_pred             CcchhhH-HHHHHhh
Confidence            4555666 7777765


No 75 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=31.39  E-value=17  Score=16.61  Aligned_cols=12  Identities=42%  Similarity=0.971  Sum_probs=8.8

Q ss_pred             cccccccccccc
Q psy1385          41 YPCGICHKEVHD   52 (69)
Q Consensus        41 ypCG~C~~eV~D   52 (69)
                      |.|.+|++...+
T Consensus         1 y~C~~C~~~f~~   12 (23)
T PF00096_consen    1 YKCPICGKSFSS   12 (23)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCccCC
Confidence            678888876654


No 76 
>smart00746 TRASH metallochaperone-like domain.
Probab=31.18  E-value=40  Score=14.90  Aligned_cols=10  Identities=30%  Similarity=1.065  Sum_probs=7.0

Q ss_pred             cccccccccc
Q psy1385          43 CGICHKEVHD   52 (69)
Q Consensus        43 CG~C~~eV~D   52 (69)
                      |..|++.|.+
T Consensus         1 c~~C~~~~~~   10 (39)
T smart00746        1 CSFCGKDIYN   10 (39)
T ss_pred             CCCCCCCccC
Confidence            6677777763


No 77 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=30.89  E-value=20  Score=21.12  Aligned_cols=26  Identities=19%  Similarity=0.627  Sum_probs=13.6

Q ss_pred             ccccccccccC-CceEEecccccceeeC
Q psy1385          43 CGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      |-+|+..-+.. -.++.|++ |...|.|
T Consensus         2 C~vC~~~~~~~hygv~~C~a-C~~FFRR   28 (70)
T smart00399        2 CCVCGDHASGFHFGVCSCRA-CKAFFRR   28 (70)
T ss_pred             CeEeCCcCcccEeCCcEech-hhhhhhh
Confidence            44554332222 23456776 7777765


No 78 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=30.87  E-value=19  Score=17.07  Aligned_cols=13  Identities=23%  Similarity=0.629  Sum_probs=8.5

Q ss_pred             Ccccccccccccc
Q psy1385          40 IYPCGICHKEVHD   52 (69)
Q Consensus        40 ~ypCG~C~~eV~D   52 (69)
                      +|.|..|.+...+
T Consensus         1 ~~~C~~C~~~F~~   13 (27)
T PF13912_consen    1 PFECDECGKTFSS   13 (27)
T ss_dssp             SEEETTTTEEESS
T ss_pred             CCCCCccCCccCC
Confidence            3677777776554


No 79 
>KOG4218|consensus
Probab=30.19  E-value=16  Score=30.29  Aligned_cols=27  Identities=30%  Similarity=0.784  Sum_probs=21.6

Q ss_pred             cccccccccccCCceE-EecccccceeeC
Q psy1385          42 PCGICHKEVHDNDQAI-LCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI-~CE~~C~~WFHR   69 (69)
                      -|..|+..|.--+..+ -||+ |..+|-|
T Consensus        17 lCPVCGDkVSGYHYGLLTCES-CKGFFKR   44 (475)
T KOG4218|consen   17 LCPVCGDKVSGYHYGLLTCES-CKGFFKR   44 (475)
T ss_pred             ccccccCccccceeeeeehhh-hhhHHHH
Confidence            5899999998877665 5887 9988865


No 80 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=30.19  E-value=13  Score=23.24  Aligned_cols=26  Identities=27%  Similarity=0.763  Sum_probs=14.8

Q ss_pred             ccccccccccC-CceEEecccccceeeC
Q psy1385          43 CGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        43 CG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      |-+|+..-+.. -.++-|++ |...|.|
T Consensus         2 C~VCg~~~~g~hygv~sC~a-C~~FFRR   28 (87)
T cd07162           2 CRVCGDRATGYHFNAMTCEG-CKGFFRR   28 (87)
T ss_pred             CcccCCcCcceEECcceehh-hHHHHHh
Confidence            55665543332 33556776 8777765


No 81 
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=30.18  E-value=32  Score=22.05  Aligned_cols=32  Identities=28%  Similarity=0.687  Sum_probs=7.5

Q ss_pred             CCCCCCCccccccccccc-cCCceEEecccccce
Q psy1385          34 NPNAPPIYPCGICHKEVH-DNDQAILCESGCNFW   66 (69)
Q Consensus        34 ~~~s~~~ypCG~C~~eV~-D~ddAI~CE~~C~~W   66 (69)
                      +...+-.-.|-+|++.|. ++.+.+.|+. -|+|
T Consensus         8 ~~~~~i~E~C~~C~~~i~~~~~~~~~C~~-GH~w   40 (99)
T PF12660_consen    8 GPGLPIFEKCPICGAPIPFDDLDEAQCEN-GHVW   40 (99)
T ss_dssp             ---------------------SSEEE-TT-S-EE
T ss_pred             cccccccccccccccccccCCcCEeECCC-CCEE
Confidence            344445578999999997 4557788998 5776


No 82 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=30.06  E-value=41  Score=20.76  Aligned_cols=13  Identities=31%  Similarity=0.664  Sum_probs=8.7

Q ss_pred             CCccccccccccc
Q psy1385          39 PIYPCGICHKEVH   51 (69)
Q Consensus        39 ~~ypCG~C~~eV~   51 (69)
                      ..+.|..|..+..
T Consensus        15 ~~~~C~~C~~~~~   27 (104)
T TIGR01384        15 GVYVCPSCGYEKE   27 (104)
T ss_pred             CeEECcCCCCccc
Confidence            3677888885543


No 83 
>KOG1829|consensus
Probab=29.83  E-value=11  Score=31.65  Aligned_cols=27  Identities=22%  Similarity=0.693  Sum_probs=17.6

Q ss_pred             Ccccccccccccc------CCceEEecccccceeeC
Q psy1385          40 IYPCGICHKEVHD------NDQAILCESGCNFWYHR   69 (69)
Q Consensus        40 ~ypCG~C~~eV~D------~ddAI~CE~~C~~WFHR   69 (69)
                      -|.|-+|  ..+|      .+....|+. |..|||+
T Consensus       511 gfiCe~C--q~~~iiyPF~~~~~~rC~~-C~avfH~  543 (580)
T KOG1829|consen  511 GFICELC--QHNDIIYPFETRNTRRCST-CLAVFHK  543 (580)
T ss_pred             eeeeeec--cCCCcccccccccceeHHH-HHHHHHH
Confidence            4667777  2222      355566777 9999995


No 84 
>KOG0383|consensus
Probab=29.56  E-value=20  Score=30.73  Aligned_cols=22  Identities=32%  Similarity=0.985  Sum_probs=15.7

Q ss_pred             cccccccccccCCceEEecccccceee
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      -|++|.    |.-..|.|++ |..|||
T Consensus        49 ~c~ic~----~~g~~l~c~t-C~~s~h   70 (696)
T KOG0383|consen   49 ACRICA----DGGELLWCDT-CPASFH   70 (696)
T ss_pred             hhhhhc----CCCcEEEecc-ccHHHH
Confidence            355553    4456778888 999999


No 85 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=29.53  E-value=40  Score=16.25  Aligned_cols=19  Identities=16%  Similarity=0.412  Sum_probs=13.7

Q ss_pred             cccccccccccCCceEEec
Q psy1385          42 PCGICHKEVHDNDQAILCE   60 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE   60 (69)
                      .|..|++.|.+++..+.-.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~   19 (39)
T smart00132        1 KCAGCGKPIRGGELVLRAL   19 (39)
T ss_pred             CccccCCcccCCcEEEEeC
Confidence            3788999998876665543


No 86 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=29.02  E-value=23  Score=26.64  Aligned_cols=23  Identities=30%  Similarity=0.863  Sum_probs=18.3

Q ss_pred             ccccccccccc--------CCceEEecccccc
Q psy1385          42 PCGICHKEVHD--------NDQAILCESGCNF   65 (69)
Q Consensus        42 pCG~C~~eV~D--------~ddAI~CE~~C~~   65 (69)
                      -||-|+..+.+        +|+-+.|.. |.+
T Consensus       199 ~C~GC~m~l~~~~~~~V~~~d~iv~CP~-CgR  229 (239)
T COG1579         199 VCGGCHMKLPSQTLSKVRKKDEIVFCPY-CGR  229 (239)
T ss_pred             cccCCeeeecHHHHHHHhcCCCCccCCc-cch
Confidence            59999987766        588889988 765


No 87 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=28.39  E-value=34  Score=17.70  Aligned_cols=15  Identities=33%  Similarity=0.651  Sum_probs=11.9

Q ss_pred             CCccccccccccccC
Q psy1385          39 PIYPCGICHKEVHDN   53 (69)
Q Consensus        39 ~~ypCG~C~~eV~D~   53 (69)
                      +.+-|..|++++.|.
T Consensus        31 p~~~C~~CGE~~~~~   45 (46)
T TIGR03831        31 PALVCPQCGEEYLDA   45 (46)
T ss_pred             CccccccCCCEeeCC
Confidence            456699999998875


No 88 
>KOG1802|consensus
Probab=28.19  E-value=44  Score=30.04  Aligned_cols=30  Identities=23%  Similarity=0.739  Sum_probs=24.3

Q ss_pred             CCCCccccccccccccCCceEEecccccceeeC
Q psy1385          37 APPIYPCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        37 s~~~ypCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      ..+.+-|-.|+  +.|..-.|.|.. |.+||=|
T Consensus        57 ~~~~~~c~Ycg--i~~p~~v~kc~~-c~Kwfcn   86 (935)
T KOG1802|consen   57 KLPEHACAYCG--ISEPACVIKCNT-CGKWFCN   86 (935)
T ss_pred             ccchhhhhhcc--CCCchheeeccc-cCceeec
Confidence            56688899997  567778999995 9999953


No 89 
>COG0295 Cdd Cytidine deaminase [Nucleotide transport and metabolism]
Probab=28.01  E-value=23  Score=24.58  Aligned_cols=16  Identities=31%  Similarity=1.020  Sum_probs=13.0

Q ss_pred             CCCCcccccccccccc
Q psy1385          37 APPIYPCGICHKEVHD   52 (69)
Q Consensus        37 s~~~ypCG~C~~eV~D   52 (69)
                      ..+.-|||.|.+-+.+
T Consensus        82 ~~~~sPCG~CRQ~i~E   97 (134)
T COG0295          82 GKPVSPCGACRQVLAE   97 (134)
T ss_pred             CCCcCCcHHHHHHHHH
Confidence            5678899999987765


No 90 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=27.73  E-value=19  Score=29.91  Aligned_cols=22  Identities=18%  Similarity=0.267  Sum_probs=17.7

Q ss_pred             ccccccCCceEEecccccceeeC
Q psy1385          47 HKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        47 ~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      .++-.|.-.+|.|+- |++||-|
T Consensus       229 ~~~g~~~~~~~YC~~-C~r~f~~  250 (470)
T COG5188         229 GMEGAEWFPKVYCVK-CGREFSR  250 (470)
T ss_pred             ccchhhhccceeeHh-hhhHhhh
Confidence            455667788999999 9999954


No 91 
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=27.64  E-value=24  Score=19.41  Aligned_cols=9  Identities=22%  Similarity=0.940  Sum_probs=3.7

Q ss_pred             Eeccccccee
Q psy1385          58 LCESGCNFWY   67 (69)
Q Consensus        58 ~CE~~C~~WF   67 (69)
                      .|+= |+.||
T Consensus         5 yCdy-C~~~~   13 (38)
T PF06220_consen    5 YCDY-CKKYL   13 (38)
T ss_dssp             B-TT-T--B-
T ss_pred             eccc-cccee
Confidence            5777 88887


No 92 
>PF14421 LmjF365940-deam:  A distinct subfamily of CDD/CDA-like deaminases
Probab=26.95  E-value=24  Score=26.42  Aligned_cols=18  Identities=28%  Similarity=0.948  Sum_probs=13.4

Q ss_pred             CCCCCCCCcccccccccc
Q psy1385          33 QNPNAPPIYPCGICHKEV   50 (69)
Q Consensus        33 q~~~s~~~ypCG~C~~eV   50 (69)
                      ....++|.+|||.|.+-+
T Consensus       147 s~~~~NPL~PCGaC~ewL  164 (193)
T PF14421_consen  147 SPRDPNPLFPCGACKEWL  164 (193)
T ss_pred             CCCCCCCCCcchHHHHHH
Confidence            345568899999998643


No 93 
>KOG1512|consensus
Probab=26.92  E-value=29  Score=28.19  Aligned_cols=25  Identities=28%  Similarity=0.705  Sum_probs=20.5

Q ss_pred             cccccccccccCCceEEecccccceee
Q psy1385          42 PCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      -|-||.+-+++ ++-++|.. |++=||
T Consensus       316 lC~IC~~P~~E-~E~~FCD~-CDRG~H  340 (381)
T KOG1512|consen  316 LCRICLGPVIE-SEHLFCDV-CDRGPH  340 (381)
T ss_pred             hhhccCCcccc-hheecccc-ccCCCC
Confidence            47788887775 57899999 999888


No 94 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=26.79  E-value=20  Score=18.41  Aligned_cols=27  Identities=26%  Similarity=0.630  Sum_probs=19.4

Q ss_pred             ccccccccccccCCceEEecccccceee
Q psy1385          41 YPCGICHKEVHDNDQAILCESGCNFWYH   68 (69)
Q Consensus        41 ypCG~C~~eV~D~ddAI~CE~~C~~WFH   68 (69)
                      --|-.|.+.+-...+++.|.. |+.=.|
T Consensus        12 ~~C~~C~~~i~~~~~~~~C~~-C~~~~H   38 (49)
T smart00109       12 TKCCVCRKSIWGSFQGLRCSW-CKVKCH   38 (49)
T ss_pred             CCccccccccCcCCCCcCCCC-CCchHH
Confidence            358888888876556888876 766544


No 95 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.65  E-value=30  Score=17.77  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=5.6

Q ss_pred             cccccccccc
Q psy1385          41 YPCGICHKEV   50 (69)
Q Consensus        41 ypCG~C~~eV   50 (69)
                      |.|..|++++
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            5566666533


No 96 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=26.61  E-value=41  Score=17.54  Aligned_cols=13  Identities=23%  Similarity=0.631  Sum_probs=7.2

Q ss_pred             ccccccccccccC
Q psy1385          41 YPCGICHKEVHDN   53 (69)
Q Consensus        41 ypCG~C~~eV~D~   53 (69)
                      |.|.+|+-.+..+
T Consensus         2 ~~C~~CGy~y~~~   14 (33)
T cd00350           2 YVCPVCGYIYDGE   14 (33)
T ss_pred             EECCCCCCEECCC
Confidence            5566666555443


No 97 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=26.25  E-value=29  Score=19.02  Aligned_cols=16  Identities=25%  Similarity=0.590  Sum_probs=10.9

Q ss_pred             CCCccccccccccccC
Q psy1385          38 PPIYPCGICHKEVHDN   53 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D~   53 (69)
                      ...+.|.+|.+.|.-+
T Consensus         2 ~~~~~C~nC~R~v~a~   17 (33)
T PF08209_consen    2 SPYVECPNCGRPVAAS   17 (33)
T ss_dssp             S-EEE-TTTSSEEEGG
T ss_pred             CCeEECCCCcCCcchh
Confidence            4568899999988653


No 98 
>PRK05578 cytidine deaminase; Validated
Probab=25.48  E-value=17  Score=24.35  Aligned_cols=15  Identities=33%  Similarity=1.037  Sum_probs=11.8

Q ss_pred             CCCcccccccccccc
Q psy1385          38 PPIYPCGICHKEVHD   52 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D   52 (69)
                      ....|||.|.+-+.|
T Consensus        81 ~~~sPCG~CRQ~l~e   95 (131)
T PRK05578         81 EPLSPCGRCRQVLAE   95 (131)
T ss_pred             CccCccHHHHHHHHH
Confidence            357899999887765


No 99 
>PF13966 zf-RVT:  zinc-binding in reverse transcriptase
Probab=25.37  E-value=47  Score=19.73  Aligned_cols=37  Identities=19%  Similarity=0.299  Sum_probs=26.0

Q ss_pred             eCCCCCCCCCCcccccccccccc-CCceEEecccccce
Q psy1385          30 FNPQNPNAPPIYPCGICHKEVHD-NDQAILCESGCNFW   66 (69)
Q Consensus        30 fn~q~~~s~~~ypCG~C~~eV~D-~ddAI~CE~~C~~W   66 (69)
                      .|-+...-.....|..|..+..| ++=-+.|..+.+.|
T Consensus        49 ~~l~~r~~~~~~~C~~C~~~~Et~~Hlf~~C~~a~~~W   86 (86)
T PF13966_consen   49 DNLQRRGIQVDPICPLCGNEEETIEHLFFHCPFARELW   86 (86)
T ss_pred             hhhhccCCccCCccccCCCccccccceeccCcCccccC
Confidence            34444555667899999998877 45666787777666


No 100
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=25.16  E-value=37  Score=22.62  Aligned_cols=14  Identities=29%  Similarity=0.937  Sum_probs=7.8

Q ss_pred             ccccccccccccCC
Q psy1385          41 YPCGICHKEVHDND   54 (69)
Q Consensus        41 ypCG~C~~eV~D~d   54 (69)
                      |.|..|+.++..+|
T Consensus       124 f~Cp~Cg~~l~~~d  137 (147)
T smart00531      124 FTCPRCGEELEEDD  137 (147)
T ss_pred             EECCCCCCEEEEcC
Confidence            55666665555443


No 101
>PF07227 DUF1423:  Protein of unknown function (DUF1423);  InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=25.02  E-value=62  Score=26.77  Aligned_cols=31  Identities=35%  Similarity=0.683  Sum_probs=23.1

Q ss_pred             CCCCCccccccccccccC---CceEEecccccceee
Q psy1385          36 NAPPIYPCGICHKEVHDN---DQAILCESGCNFWYH   68 (69)
Q Consensus        36 ~s~~~ypCG~C~~eV~D~---ddAI~CE~~C~~WFH   68 (69)
                      .=.....|-+|++ +.++   =-+|.|+. |.-|=|
T Consensus       124 gFC~~C~C~iC~k-fD~~~n~~~Wi~Cd~-CgH~cH  157 (446)
T PF07227_consen  124 GFCRRCMCCICSK-FDDNKNTCSWIGCDV-CGHWCH  157 (446)
T ss_pred             CccccCCccccCC-cccCCCCeeEEeccC-CCceeh
Confidence            3345678999999 4333   35899997 999988


No 102
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=25.01  E-value=36  Score=19.98  Aligned_cols=13  Identities=23%  Similarity=0.675  Sum_probs=9.7

Q ss_pred             CCCcccccccccc
Q psy1385          38 PPIYPCGICHKEV   50 (69)
Q Consensus        38 ~~~ypCG~C~~eV   50 (69)
                      .....||.|++.+
T Consensus        29 ~~klrCGaCs~vl   41 (46)
T PF11331_consen   29 QQKLRCGACSEVL   41 (46)
T ss_pred             eeEEeCCCCceeE
Confidence            3467799998765


No 103
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=24.44  E-value=38  Score=22.04  Aligned_cols=9  Identities=33%  Similarity=1.342  Sum_probs=6.9

Q ss_pred             cccccceee
Q psy1385          60 ESGCNFWYH   68 (69)
Q Consensus        60 E~~C~~WFH   68 (69)
                      ..||.+||.
T Consensus        58 ~~GC~~Wf~   66 (84)
T TIGR01374        58 SGGCRRWFN   66 (84)
T ss_pred             CCCCcCeEE
Confidence            457999985


No 104
>PF12773 DZR:  Double zinc ribbon
Probab=23.74  E-value=56  Score=17.59  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=10.1

Q ss_pred             CccccccccccccCCceEEec
Q psy1385          40 IYPCGICHKEVHDNDQAILCE   60 (69)
Q Consensus        40 ~ypCG~C~~eV~D~ddAI~CE   60 (69)
                      ...|..|++++..  ++.+|.
T Consensus        29 ~~~C~~Cg~~~~~--~~~fC~   47 (50)
T PF12773_consen   29 KKICPNCGAENPP--NAKFCP   47 (50)
T ss_pred             CCCCcCCcCCCcC--CcCccC
Confidence            4556666666443  444444


No 105
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=22.87  E-value=57  Score=18.68  Aligned_cols=27  Identities=22%  Similarity=0.672  Sum_probs=17.5

Q ss_pred             Ccccccccccccc------CCceEEeccccccee
Q psy1385          40 IYPCGICHKEVHD------NDQAILCESGCNFWY   67 (69)
Q Consensus        40 ~ypCG~C~~eV~D------~ddAI~CE~~C~~WF   67 (69)
                      ...|..|...-.-      ....++|++ |..+|
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCna-Cgl~~   35 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNA-CGLYY   35 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeec-ccHHH
Confidence            4678888754332      133499997 88765


No 106
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=22.70  E-value=40  Score=20.37  Aligned_cols=27  Identities=22%  Similarity=0.621  Sum_probs=17.8

Q ss_pred             cccccccccccC-CceEEecccccceeeC
Q psy1385          42 PCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        42 pCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      +|-+|+..-... -.++-|++ |...|.|
T Consensus         2 ~C~VCg~~~~g~hyGv~sC~a-C~~FFRR   29 (75)
T cd06969           2 LCAVCGDNAACQHYGVRTCEG-CKGFFKR   29 (75)
T ss_pred             CCeecCCcCcceEECcceeee-eeeeeee
Confidence            467776544443 34566777 9998876


No 107
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.51  E-value=1e+02  Score=20.81  Aligned_cols=29  Identities=21%  Similarity=0.423  Sum_probs=20.5

Q ss_pred             CCCCccccccccccccCCceEEecccccceeeC
Q psy1385          37 APPIYPCGICHKEVHDNDQAILCESGCNFWYHR   69 (69)
Q Consensus        37 s~~~ypCG~C~~eV~D~ddAI~CE~~C~~WFHR   69 (69)
                      +.+.-.|..|+.   -.+....|.. |..=+||
T Consensus       306 ~~tS~~C~~cg~---~~~r~~~C~~-cg~~~~r  334 (364)
T COG0675         306 YYTSKTCPCCGH---LSGRLFKCPR-CGFVHDR  334 (364)
T ss_pred             CCCcccccccCC---ccceeEECCC-CCCeehh
Confidence            344456777877   3457788988 8887776


No 108
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=22.33  E-value=15  Score=22.26  Aligned_cols=14  Identities=29%  Similarity=0.866  Sum_probs=8.4

Q ss_pred             ceEEecccccceeeC
Q psy1385          55 QAILCESGCNFWYHR   69 (69)
Q Consensus        55 dAI~CE~~C~~WFHR   69 (69)
                      .++.|++ |...|.|
T Consensus        14 gv~sC~a-Ck~FFRR   27 (75)
T cd07155          14 GVASCEA-CKAFFKR   27 (75)
T ss_pred             Chhhhhh-hHHHHHH
Confidence            3455666 7766654


No 109
>PHA03256 BDLF3; Provisional
Probab=22.32  E-value=22  Score=23.33  Aligned_cols=7  Identities=14%  Similarity=0.135  Sum_probs=6.0

Q ss_pred             ccceeeC
Q psy1385          63 CNFWYHR   69 (69)
Q Consensus        63 C~~WFHR   69 (69)
                      |+.||||
T Consensus        25 ~~~ff~r   31 (77)
T PHA03256         25 LLSWDPT   31 (77)
T ss_pred             HHHHcCC
Confidence            7889987


No 110
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=21.89  E-value=84  Score=16.18  Aligned_cols=24  Identities=21%  Similarity=0.625  Sum_probs=12.6

Q ss_pred             ccccccccccc-------cCCceEEecccccc
Q psy1385          41 YPCGICHKEVH-------DNDQAILCESGCNF   65 (69)
Q Consensus        41 ypCG~C~~eV~-------D~ddAI~CE~~C~~   65 (69)
                      +.|..|+..+.       ++...+.|-. |+.
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~~~~v~C~~-C~~   33 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGANGGKVRCGK-CGH   33 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCCCCEEECCC-CCC
Confidence            45677776321       2233477766 653


No 111
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=21.86  E-value=79  Score=20.83  Aligned_cols=34  Identities=29%  Similarity=0.643  Sum_probs=21.9

Q ss_pred             CCCCCCcccccccccccc-----CCceEEecccccceeeC
Q psy1385          35 PNAPPIYPCGICHKEVHD-----NDQAILCESGCNFWYHR   69 (69)
Q Consensus        35 ~~s~~~ypCG~C~~eV~D-----~ddAI~CE~~C~~WFHR   69 (69)
                      .+.+..|.|..|++....     +---+.|.. |..-|+|
T Consensus        16 ~klpt~f~CP~Cge~~v~v~~~k~~~h~~C~~-CG~y~~~   54 (99)
T PRK14892         16 PKLPKIFECPRCGKVSISVKIKKNIAIITCGN-CGLYTEF   54 (99)
T ss_pred             cCCCcEeECCCCCCeEeeeecCCCcceEECCC-CCCccCE
Confidence            455678999999943331     234677877 8766543


No 112
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=21.25  E-value=74  Score=16.84  Aligned_cols=13  Identities=15%  Similarity=0.534  Sum_probs=7.5

Q ss_pred             ceEEecccccceee
Q psy1385          55 QAILCESGCNFWYH   68 (69)
Q Consensus        55 dAI~CE~~C~~WFH   68 (69)
                      -.+.|+. |+.|++
T Consensus        15 T~~~C~~-C~v~lC   27 (32)
T PF13842_consen   15 TRYMCSK-CDVPLC   27 (32)
T ss_pred             eEEEccC-CCCccc
Confidence            4556666 666554


No 113
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=21.23  E-value=72  Score=17.02  Aligned_cols=21  Identities=19%  Similarity=0.613  Sum_probs=12.6

Q ss_pred             cccccccccccCCceEEeccccc
Q psy1385          42 PCGICHKEVHDNDQAILCESGCN   64 (69)
Q Consensus        42 pCG~C~~eV~D~ddAI~CE~~C~   64 (69)
                      .|++|.+++.+++.  ..-.+|.
T Consensus         1 ~C~~C~~~~~~~~~--~~l~~Cg   21 (44)
T PF14634_consen    1 HCNICFEKYSEERR--PRLTSCG   21 (44)
T ss_pred             CCcCcCccccCCCC--eEEcccC
Confidence            38899999944333  3334443


No 114
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=21.10  E-value=51  Score=18.44  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=7.1

Q ss_pred             Cccccccccccc
Q psy1385          40 IYPCGICHKEVH   51 (69)
Q Consensus        40 ~ypCG~C~~eV~   51 (69)
                      .+.|.+|.+.+.
T Consensus        31 ~v~CPiC~~~~~   42 (54)
T PF05605_consen   31 NVVCPICSSRVT   42 (54)
T ss_pred             CccCCCchhhhh
Confidence            466666665544


No 115
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=21.04  E-value=24  Score=18.56  Aligned_cols=21  Identities=29%  Similarity=0.784  Sum_probs=15.3

Q ss_pred             ccccccccccC-----CceEEeccccc
Q psy1385          43 CGICHKEVHDN-----DQAILCESGCN   64 (69)
Q Consensus        43 CG~C~~eV~D~-----ddAI~CE~~C~   64 (69)
                      |-.|++.|.+.     ..+++|-. |+
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~-C~   31 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVE-CQ   31 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HH-HH
T ss_pred             ccccCChHHHHHHHhCCCcEECHH-Hh
Confidence            88999999884     78888876 65


No 116
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=20.79  E-value=47  Score=16.87  Aligned_cols=11  Identities=36%  Similarity=0.960  Sum_probs=8.9

Q ss_pred             ccccccccccc
Q psy1385          41 YPCGICHKEVH   51 (69)
Q Consensus        41 ypCG~C~~eV~   51 (69)
                      ..|.+|.+.|.
T Consensus         2 v~CPiC~~~v~   12 (26)
T smart00734        2 VQCPVCFREVP   12 (26)
T ss_pred             CcCCCCcCccc
Confidence            46999999884


No 117
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=20.54  E-value=84  Score=19.76  Aligned_cols=15  Identities=20%  Similarity=0.483  Sum_probs=11.5

Q ss_pred             CCCcccccccccccc
Q psy1385          38 PPIYPCGICHKEVHD   52 (69)
Q Consensus        38 ~~~ypCG~C~~eV~D   52 (69)
                      ..+-||..|..++.+
T Consensus         4 d~lKPCPFCG~~~~~   18 (64)
T PRK09710          4 DNVKPCPFCGCPSVT   18 (64)
T ss_pred             ccccCCCCCCCceeE
Confidence            456789999887766


No 118
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=20.30  E-value=55  Score=16.96  Aligned_cols=26  Identities=27%  Similarity=0.678  Sum_probs=19.0

Q ss_pred             cccccccccccC-CceEEecccccceee
Q psy1385          42 PCGICHKEVHDN-DQAILCESGCNFWYH   68 (69)
Q Consensus        42 pCG~C~~eV~D~-ddAI~CE~~C~~WFH   68 (69)
                      -|-.|.+.+..- .+++.|+. |+.=.|
T Consensus        13 ~C~~C~~~i~~~~~~~~~C~~-C~~~~H   39 (50)
T cd00029          13 FCDVCRKSIWGLFKQGLRCSW-CKVKCH   39 (50)
T ss_pred             ChhhcchhhhccccceeEcCC-CCCchh
Confidence            488888888754 58888877 776555


No 119
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=20.16  E-value=48  Score=21.80  Aligned_cols=28  Identities=29%  Similarity=0.726  Sum_probs=20.5

Q ss_pred             ccccccccccccC-CceEEecccccceeeC
Q psy1385          41 YPCGICHKEVHDN-DQAILCESGCNFWYHR   69 (69)
Q Consensus        41 ypCG~C~~eV~D~-ddAI~CE~~C~~WFHR   69 (69)
                      -+|-+|+..-... =.++-|++ |...|.|
T Consensus         7 ~~C~VCg~~a~g~hyGv~sC~a-Ck~FFRR   35 (107)
T cd06955           7 RICGVCGDRATGFHFNAMTCEG-CKGFFRR   35 (107)
T ss_pred             CCCeecCCcCcccEECcceeee-ecceecc
Confidence            4599998755553 35667877 9999987


Done!