Diaphorina citri psyllid: psy13876


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MRIATGASMVGKHWILGLLRYWQNPTMLQNYCILHGLFVCSSPGLLSDTYIEAQRIQCLSKALEDDKPAGTLSEEEMAELGGDQFYSKLAASLAPEIYGHEDVKKALLLLLVGGVDRS
ccccccccccccEEEEEEEEccccccccccEEEEEEEEEccccccccccEEEEEEEEEccccccccccccccHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHcccccc
*******SMVGKHWILGLLRYWQNPTMLQNYCILHGLFVCSSPGLLSDTYIEAQRIQCLSK***************M*ELGGDQFYSKLAASLAPEIYGHEDVKKALLLLLVGGVD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGASMVGKHWILGLLRYWQNPTMLQNYCILHGLFVCSSPGLLSDTYIEAQRIQCLSKALEDDKPAGTLSEEEMAELGGDQFYSKLAASLAPEIYGHEDVKKALLLLLVGGVDRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentP33993
DNA replication licensing factor Mcm7 Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.confidentQ9XYU0
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentQ3ZBH9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042555 [CC]MCM complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006261 [BP]DNA-dependent DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0043138 [MF]3'-5' DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 6-116
View the alignment between query and template
View the model in PyMOL