Query         psy13877
Match_columns 114
No_of_seqs    122 out of 341
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 22:41:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13877.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13877hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0482|consensus               99.8 3.9E-21 8.4E-26  169.2   1.3   67    1-67    205-289 (721)
  2 KOG0480|consensus               99.5   3E-15 6.5E-20  134.0   4.3   86    1-98    181-284 (764)
  3 smart00350 MCM minichromosome   99.4 1.6E-13 3.4E-18  117.2   6.4   53    1-56     61-128 (509)
  4 COG1241 MCM2 Predicted ATPase   99.2 1.7E-11 3.6E-16  110.0   6.4   73    2-77    154-253 (682)
  5 KOG0479|consensus               99.2   2E-11 4.3E-16  109.6   5.4   67   14-80    180-271 (818)
  6 PTZ00111 DNA replication licen  99.1 5.9E-11 1.3E-15  109.2   5.8   50    7-56    286-370 (915)
  7 KOG0477|consensus               99.0 3.4E-10 7.4E-15  102.2   3.7   69    2-75    318-413 (854)
  8 KOG0478|consensus               98.4 2.1E-07 4.5E-12   84.8   3.9   46   11-56    293-353 (804)
  9 KOG0481|consensus               98.4 3.3E-07 7.3E-12   82.0   4.0   43   14-56    202-259 (729)
 10 cd04486 YhcR_OBF_like YhcR_OBF  81.2     1.9 4.1E-05   28.8   2.9   25   45-69     44-69  (78)
 11 COG2871 NqrF Na+-transporting   79.8     1.8 3.8E-05   37.5   2.9   27   31-57    230-265 (410)
 12 smart00739 KOW KOW (Kyprides,   56.7      19  0.0004   18.5   2.8   22   46-68      2-23  (28)
 13 COG4043 Preprotein translocase  55.6     4.1 8.8E-05   30.0   0.1   23   45-67     33-64  (111)
 14 cd04482 RPA2_OBF_like RPA2_OBF  53.6      13 0.00029   25.2   2.4   17   45-61     47-64  (91)
 15 CHL00143 rpl3 ribosomal protei  39.0      44 0.00094   26.8   3.6   38   25-63     77-119 (207)
 16 PF00970 FAD_binding_6:  Oxidor  38.8      20 0.00043   23.3   1.4   14   45-58     81-94  (99)
 17 PRK03760 hypothetical protein;  38.4      22 0.00048   25.5   1.7   11   45-55    105-115 (117)
 18 PRK11507 ribosome-associated p  36.0      29 0.00064   23.4   1.9   14   43-56     50-63  (70)
 19 smart00276 GLECT Galectin. Gal  34.9      60  0.0013   22.8   3.4   30   39-70      4-35  (128)
 20 COG2012 RPB5 DNA-directed RNA   32.8      27  0.0006   24.4   1.4   12   45-56     54-65  (80)
 21 PF12249 AftA_C:  Arabinofurano  32.5      52  0.0011   26.1   3.0   42   35-77     22-84  (178)
 22 PF08021 FAD_binding_9:  Sidero  31.5      25 0.00054   24.8   1.0   14   45-58    101-114 (117)
 23 PF02769 AIRS_C:  AIR synthase   30.9      32 0.00069   23.8   1.5   11   47-57      1-11  (153)
 24 cd04088 EFG_mtEFG_II EFG_mtEFG  30.5 1.5E+02  0.0032   18.8   4.7   28   28-56     44-71  (83)
 25 KOG3416|consensus               30.1      32 0.00069   26.1   1.4   13   44-56     60-72  (134)
 26 COG0611 ThiL Thiamine monophos  29.2      41 0.00089   28.4   2.1   23   45-67    147-171 (317)
 27 cd06188 NADH_quinone_reductase  28.6 1.2E+02  0.0025   23.8   4.4   19   39-57    116-140 (283)
 28 cd04487 RecJ_OBF2_like RecJ_OB  28.4      66  0.0014   21.0   2.6   18   45-62     43-61  (73)
 29 PF07425 Pardaxin:  Pardaxin;    27.7      25 0.00053   20.6   0.4   12   93-104    22-33  (33)
 30 KOG1749|consensus               27.4      61  0.0013   24.7   2.5   32   46-78     94-134 (143)
 31 PF07287 DUF1446:  Protein of u  27.2      80  0.0017   27.0   3.5   27   24-61    277-307 (362)
 32 PF02643 DUF192:  Uncharacteriz  27.1      20 0.00044   25.0  -0.1   11   45-55     97-107 (108)
 33 PF01191 RNA_pol_Rpb5_C:  RNA p  26.8      56  0.0012   22.1   2.1   18   45-62     48-65  (74)
 34 PF02080 TrkA_C:  TrkA-C domain  26.8      36 0.00079   20.7   1.1   17   40-56     41-58  (71)
 35 PRK08051 fre FMN reductase; Va  26.4      80  0.0017   23.9   3.1   30   45-74     79-114 (232)
 36 KOG2241|consensus               25.8      56  0.0012   27.1   2.3   14   41-56    186-199 (255)
 37 TIGR03595 Obg_CgtA_exten Obg f  25.0      55  0.0012   21.4   1.7   12   45-56     53-64  (69)
 38 PF13567 DUF4131:  Domain of un  24.8 1.2E+02  0.0026   20.4   3.5   11   46-56    129-139 (176)
 39 COG2375 ViuB Siderophore-inter  24.6      91   0.002   25.8   3.3   34   45-78    121-159 (265)
 40 cd06193 siderophore_interactin  24.5      91   0.002   23.7   3.1   35   45-79     98-137 (235)
 41 COG3450 Predicted enzyme of th  24.5 1.4E+02   0.003   21.8   3.9   40   12-54     53-94  (116)
 42 PF14801 GCD14_N:  tRNA methylt  24.4      50  0.0011   21.5   1.4   14   46-59      6-19  (54)
 43 PRK09570 rpoH DNA-directed RNA  23.7      62  0.0013   22.3   1.8   15   45-59     51-65  (79)
 44 cd04496 SSB_OBF SSB_OBF: A sub  23.3      54  0.0012   21.1   1.4   12   45-56     61-72  (100)
 45 cd04092 mtEFG2_II_like mtEFG2_  22.5 2.2E+02  0.0047   18.1   4.8   27   29-56     45-71  (83)
 46 PRK14105 selenophosphate synth  22.2      63  0.0014   26.4   1.9   22   39-60    158-179 (345)
 47 PRK06863 single-stranded DNA-b  22.0      69  0.0015   24.6   2.0   44   45-89     69-121 (168)
 48 TIGR00621 ssb single stranded   21.8      72  0.0016   23.8   2.0   35   45-79     68-111 (164)
 49 cd06190 T4MO_e_transfer_like T  21.0 1.2E+02  0.0025   22.6   3.0   28   46-73     75-108 (232)
 50 cd06189 flavin_oxioreductase N  20.8 1.1E+02  0.0024   22.7   2.9   13   45-57     75-87  (224)
 51 PF02874 ATP-synt_ab_N:  ATP sy  20.7      69  0.0015   19.8   1.5   12   45-56     58-69  (69)
 52 cd02691 PurM-like2 AIR synthas  20.6      71  0.0015   26.6   1.9   16   44-59    158-173 (346)
 53 TIGR03625 L3_bact 50S ribosoma  20.4 1.2E+02  0.0026   24.2   3.1   38   25-63     74-116 (202)
 54 TIGR00739 yajC preprotein tran  20.3      70  0.0015   21.8   1.5   12   45-56     37-48  (84)

No 1  
>KOG0482|consensus
Probab=99.81  E-value=3.9e-21  Score=169.16  Aligned_cols=67  Identities=51%  Similarity=0.877  Sum_probs=65.2

Q ss_pred             CCCcccccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc---CCCCcc
Q psy13877          1 MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN---PPVQTG   62 (114)
Q Consensus         1 ~Cps~~C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG---p~p~tg   62 (114)
                      .|||+.|+.|+.+|+|+|++|+|||++|||+++||++++||.||               .|+|||+|.|+|   |.||+|
T Consensus       205 ~CpS~eC~~n~~~G~L~lqtRgSKFikfQe~kmQEls~qVPvG~IPRsltv~~~ge~tr~~~PGDvV~vsGiFLP~pytG  284 (721)
T KOG0482|consen  205 ECPSEECRTNKAGGRLYLQTRGSKFIKFQEVKMQELSDQVPVGHIPRSLTVHVYGEMTRKCQPGDVVVVSGIFLPIPYTG  284 (721)
T ss_pred             hCChHHhhhcccCCeEEEEecccccchhhhhhHHHHhccCCCCccCceeEEEEecccceecCCCCEEEEeeeecccchhh
Confidence            49999999999999999999999999999999999999999999               589999999999   999999


Q ss_pred             eeeee
Q psy13877         63 QKMIV   67 (114)
Q Consensus        63 f~a~~   67 (114)
                      |++++
T Consensus       285 fr~~~  289 (721)
T KOG0482|consen  285 FRALK  289 (721)
T ss_pred             HHHHH
Confidence            99987


No 2  
>KOG0480|consensus
Probab=99.55  E-value=3e-15  Score=133.99  Aligned_cols=86  Identities=22%  Similarity=0.414  Sum_probs=69.8

Q ss_pred             CCCcccccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc---CCCCcc
Q psy13877          1 MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN---PPVQTG   62 (114)
Q Consensus         1 ~Cps~~C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG---p~p~tg   62 (114)
                      .|||+.|.   ++-+|.+....|+|+|||+|||||+.+++|.|+               .|+|||+|+|||   .+|+..
T Consensus       181 ~C~np~C~---nrr~f~l~~~~s~f~D~QkIrIQE~~~E~p~GsiPRtvdviLr~dlVe~~~pGD~v~~TGiliVvpdv~  257 (764)
T KOG0480|consen  181 KCPNPVCS---NRRSFTLDRSSSRFLDWQKIRIQELQAEIPRGSIPRTVDVILRGDLVETAQPGDKVDITGILIVVPDVS  257 (764)
T ss_pred             cCCCcccc---CCceeeeecccceeeeeeeeehhhhhhhCCCCCCCceeEEEEhhhhHhhcCCCCEEEEEEEEEEecChH
Confidence            49999994   566899999999999999999999999999999               589999999999   667643


Q ss_pred             eeeeeecCCCCCcchhhhhhhcCCccccccchhhhh
Q psy13877         63 QKMIVLTNNSNPPALEEKKFDRGIYNNEGLIASKLM   98 (114)
Q Consensus        63 f~a~~l~n~v~~~~~~~~~~~~g~~~~~g~~~~~~~   98 (114)
                      .        +..|.++.+.- ||+...+|++|++-+
T Consensus       258 ~--------l~~pgsk~~n~-r~~~~~~~i~~lkal  284 (764)
T KOG0480|consen  258 Q--------LGGPGSKAENN-RGGETGDGITGLKAL  284 (764)
T ss_pred             H--------hcCCccccccc-cCCCcccceeeehhc
Confidence            3        44455666533 366556899998765


No 3  
>smart00350 MCM minichromosome  maintenance proteins.
Probab=99.44  E-value=1.6e-13  Score=117.25  Aligned_cols=53  Identities=30%  Similarity=0.616  Sum_probs=48.4

Q ss_pred             CCCcccccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc
Q psy13877          1 MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN   56 (114)
Q Consensus         1 ~Cps~~C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG   56 (114)
                      .|+++.|   +++++|.++...|+|+|||+|+|||.|+++|.|+               .++|||+|.|+|
T Consensus        61 ~C~~~~C---~~~~~f~l~~~~s~~~D~Q~I~iQE~~e~~p~G~~Prsi~v~l~~dLvd~~~PGD~V~i~G  128 (509)
T smart00350       61 VCPPREC---QSPTPFSLNHERSTFIDFQKIKLQESPEEVPAGQLPRSVDVILDGDLVDKAKPGDRVEVTG  128 (509)
T ss_pred             cCCCCcC---CCCCceEeccCCCeEEEEEEEEEEcCcccCCCCCCCcEEEEEEcccccCcccCCCEEEEEE
Confidence            3888778   4566799999999999999999999999999999               589999999999


No 4  
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]
Probab=99.22  E-value=1.7e-11  Score=109.97  Aligned_cols=73  Identities=26%  Similarity=0.328  Sum_probs=60.9

Q ss_pred             CCcccccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc---CCC----
Q psy13877          2 CPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN---PPV----   59 (114)
Q Consensus         2 Cps~~C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG---p~p----   59 (114)
                      |++  | ....+++|.+..+.|+|+|||+|+|||.|+.+|+|+               .++|||+|.+||   +.|    
T Consensus       154 C~~--~-~~~~~~~~~~~~~~s~f~d~Q~vkiQE~pe~~p~g~~Prs~~vil~~dlv~~~~pGdrV~itGi~~~~~~~~~  230 (682)
T COG1241         154 CEN--C-GKFGKGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSL  230 (682)
T ss_pred             CCC--c-cccCCCceEEecCcceeeeceEEEEecCcccCCCCCCCceEEEEEecCcccccCCCCEEEEEEEEeccccccc
Confidence            777  4 223678999999999999999999999999999998               589999999999   444    


Q ss_pred             -----CcceeeeeecCCCCCcch
Q psy13877         60 -----QTGQKMIVLTNNSNPPAL   77 (114)
Q Consensus        60 -----~tgf~a~~l~n~v~~~~~   77 (114)
                           ...|+.++.+|++.....
T Consensus       231 ~~~~~~~~~~~~~~a~~v~~~~~  253 (682)
T COG1241         231 SGRRKGPVFEIYLEANSVEKLDK  253 (682)
T ss_pred             ccccCCceEEEEEEEEEEEeccc
Confidence                 334788888888776664


No 5  
>KOG0479|consensus
Probab=99.19  E-value=2e-11  Score=109.62  Aligned_cols=67  Identities=18%  Similarity=0.223  Sum_probs=59.1

Q ss_pred             cceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc-----CC-----CCcceeeeee
Q psy13877         14 GRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN-----PP-----VQTGQKMIVL   68 (114)
Q Consensus        14 G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG-----p~-----p~tgf~a~~l   68 (114)
                      -.|......|+|.|||.|.|||+||..|+|+               ++||||+|.|.|     |.     ...+|++++|
T Consensus       180 N~L~TEyGlS~ykDHQtitiQEmPE~APaGQLPRSVDvilddDLVD~~KPGDRV~ivG~yr~Lp~k~~g~tsg~FRTvli  259 (818)
T KOG0479|consen  180 NLLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDRVKPGDRVNIVGIYRSLPGKSNGNTSGTFRTVLI  259 (818)
T ss_pred             CeeeEeecceeeecccEEEeeeccccCCCCCCCcceeEEecccccccCCCCCeeEEEEEEeeccCccCCcccceeEEEEE
Confidence            4688889999999999999999999999999               689999999999     32     2344999999


Q ss_pred             cCCCCCcchhhh
Q psy13877         69 TNNSNPPALEEK   80 (114)
Q Consensus        69 ~n~v~~~~~~~~   80 (114)
                      +|||.+++.+++
T Consensus       260 aNni~~l~ke~~  271 (818)
T KOG0479|consen  260 ANNIELLSKEAA  271 (818)
T ss_pred             eccHHhhccccc
Confidence            999999998754


No 6  
>PTZ00111 DNA replication licensing factor MCM4; Provisional
Probab=99.13  E-value=5.9e-11  Score=109.20  Aligned_cols=50  Identities=12%  Similarity=0.076  Sum_probs=44.6

Q ss_pred             ccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC-----------------------------------CCCCCcE
Q psy13877          7 CQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM-----------------------------------GSSPAQV   51 (114)
Q Consensus         7 C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~-----------------------------------~~kPGD~   51 (114)
                      |..|+++++|.|+.+.|+|+|||+|+|||.|+.+|.|+                                   .|+|||+
T Consensus       286 C~~C~~~~~f~l~~~~s~f~D~Q~IklQE~pe~vp~G~~P~~~~~~~~~~~~~~~~~~~~rsi~v~l~dDLVD~v~PGDr  365 (915)
T PTZ00111        286 CNECNSKYTFELNHNMCVYSTKKIVKLLQSNSSLNNPDKDGLDNSVDNSGLNGEIYMKDNEVINLNLYDDLIDSVKTGDR  365 (915)
T ss_pred             CCCCCCCCCeEEccCccEEEeeeEEEEeeCcccCCCCCCCccccccccccccccccccCCceEEEEEecchhccCCCCCE
Confidence            44447889999999999999999999999999998763                                   4799999


Q ss_pred             EEEEc
Q psy13877         52 VKLTN   56 (114)
Q Consensus        52 V~lTG   56 (114)
                      |+|||
T Consensus       366 V~VtG  370 (915)
T PTZ00111        366 VTVVG  370 (915)
T ss_pred             EEEEE
Confidence            99999


No 7  
>KOG0477|consensus
Probab=98.97  E-value=3.4e-10  Score=102.24  Aligned_cols=69  Identities=19%  Similarity=0.419  Sum_probs=59.0

Q ss_pred             CCcccccCCCCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc--CCCCcc--
Q psy13877          2 CPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN--PPVQTG--   62 (114)
Q Consensus         2 Cps~~C~~n~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG--p~p~tg--   62 (114)
                      ||+  |   +++|+|.++++...|.+||+|+|||.|..||+|.               .|+|||.|.+||  ..-|.|  
T Consensus       318 C~~--c---qSkGpf~vn~e~TvyrnYQritiQEspg~v~~GrlPRsk~vILl~DLvD~~kpGdEievTGIy~nn~d~sL  392 (854)
T KOG0477|consen  318 CPE--C---QSKGPFEVNVEETVYRNYQRITIQESPGTVPAGRLPRSKEVILLADLVDSCKPGDEIEVTGIYTNNFDGSL  392 (854)
T ss_pred             Ccc--c---cCCCCCccchhhhhhcccceeeeccCCCcCCCCccccchhheehhhhhhhcCCCcceEEeeeecccccccc
Confidence            666  6   7899999999999999999999999999999999               589999999999  333333  


Q ss_pred             --------eeeeeecCCCCCc
Q psy13877         63 --------QKMIVLTNNSNPP   75 (114)
Q Consensus        63 --------f~a~~l~n~v~~~   75 (114)
                              |.+++++|.|.--
T Consensus       393 N~kngFpvfatvi~ANhV~~k  413 (854)
T KOG0477|consen  393 NTKNGFPVFATVIEANHVVKK  413 (854)
T ss_pred             cccCCccccceeheehhhhhh
Confidence                    7889999976543


No 8  
>KOG0478|consensus
Probab=98.41  E-value=2.1e-07  Score=84.75  Aligned_cols=46  Identities=24%  Similarity=0.304  Sum_probs=42.8

Q ss_pred             CCccceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc
Q psy13877         11 KSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN   56 (114)
Q Consensus        11 ~s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG   56 (114)
                      +.+-.|.|....|.|.|-|-||+||.|+.+|.|+               .++|||+|.|||
T Consensus       293 ~~~~~~~Lihnrs~F~dkQviklqEspd~~p~g~tPhtv~v~~~~dLVD~v~pGDrv~VTG  353 (804)
T KOG0478|consen  293 GTTNSFQLLHNRSEFADKQVIKLQESPDDMPEGSTPHTVSVVLHNDLVDKVRPGDRVEVTG  353 (804)
T ss_pred             cCcccceeehhhhhhcccceeeeeeccccCcCCCCCceEEEEEehhhhhccCCCCeEEEEE
Confidence            5555699999999999999999999999999999               689999999999


No 9  
>KOG0481|consensus
Probab=98.36  E-value=3.3e-07  Score=82.05  Aligned_cols=43  Identities=26%  Similarity=0.297  Sum_probs=41.0

Q ss_pred             cceEEEecCceeeeceEeeeeccCCCCCCCC---------------CCCCCcEEEEEc
Q psy13877         14 GRLYLQTRGSKFVKFQELKVQEHTSNQPLQM---------------GSSPAQVVKLTN   56 (114)
Q Consensus        14 G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~---------------~~kPGD~V~lTG   56 (114)
                      -+|.+.++.|+|+|+|.+++||.||.||.|+               .+.||.+|+|+|
T Consensus       202 DPyii~pdks~~vD~QtLKLQE~pe~VP~GE~PRhl~L~~dRyL~~kvvPG~RvtI~G  259 (729)
T KOG0481|consen  202 DPYIIMPDKSKCVDQQTLKLQELPEDVPVGEMPRHLQLFCDRYLTNKVVPGNRVTIMG  259 (729)
T ss_pred             CCEEEcccccceeehhheehhhCcccCCcCcCcchhhhhhhHHHhccccCCceEEEEE
Confidence            4689999999999999999999999999999               589999999999


No 10 
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.
Probab=81.20  E-value=1.9  Score=28.81  Aligned_cols=25  Identities=12%  Similarity=0.147  Sum_probs=19.7

Q ss_pred             CCCCCcEEEEEc-CCCCcceeeeeec
Q psy13877         45 GSSPAQVVKLTN-PPVQTGQKMIVLT   69 (114)
Q Consensus        45 ~~kPGD~V~lTG-p~p~tgf~a~~l~   69 (114)
                      .+++||+|.|+| ...|.|...|..+
T Consensus        44 ~~~~Gd~V~vtG~v~ey~g~tql~~~   69 (78)
T cd04486          44 DVAVGDLVRVTGTVTEYYGLTQLTAV   69 (78)
T ss_pred             CCCCCCEEEEEEEEEeeCCeEEEccC
Confidence            478999999999 8888886665533


No 11 
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]
Probab=79.79  E-value=1.8  Score=37.50  Aligned_cols=27  Identities=15%  Similarity=0.415  Sum_probs=21.1

Q ss_pred             eeeeccCC---CCCCCC------CCCCCcEEEEEcC
Q psy13877         31 LKVQEHTS---NQPLQM------GSSPAQVVKLTNP   57 (114)
Q Consensus        31 VrIQE~pe---eVP~G~------~~kPGD~V~lTGp   57 (114)
                      |||--+|-   ++|.|.      .++|||+|+|+||
T Consensus       230 vRIAtPPp~~~~~PpG~mSSyi~sLKpGDKvtisGP  265 (410)
T COG2871         230 VRIATPPPRNPDAPPGQMSSYIWSLKPGDKVTISGP  265 (410)
T ss_pred             EEeccCCCCCCCCCccceeeeEEeecCCCeEEEecc
Confidence            56655543   678888      6899999999994


No 12 
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=56.73  E-value=19  Score=18.52  Aligned_cols=22  Identities=18%  Similarity=0.098  Sum_probs=15.5

Q ss_pred             CCCCcEEEEEcCCCCcceeeeee
Q psy13877         46 SSPAQVVKLTNPPVQTGQKMIVL   68 (114)
Q Consensus        46 ~kPGD~V~lTGp~p~tgf~a~~l   68 (114)
                      ..+||.|.|++ -|+.|+.+.++
T Consensus         2 ~~~G~~V~I~~-G~~~g~~g~i~   23 (28)
T smart00739        2 FEVGDTVRVIA-GPFKGKVGKVL   23 (28)
T ss_pred             CCCCCEEEEeE-CCCCCcEEEEE
Confidence            47999999988 23666666553


No 13 
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=55.63  E-value=4.1  Score=29.97  Aligned_cols=23  Identities=9%  Similarity=0.108  Sum_probs=18.2

Q ss_pred             CCCCCcEEEEEc---------CCCCcceeeee
Q psy13877         45 GSSPAQVVKLTN---------PPVQTGQKMIV   67 (114)
Q Consensus        45 ~~kPGD~V~lTG---------p~p~tgf~a~~   67 (114)
                      +++|||.+.|+|         ...|..|++|.
T Consensus        33 ~ik~GD~IiF~~~~l~v~V~~vr~Y~tF~~ml   64 (111)
T COG4043          33 QIKPGDKIIFNGDKLKVEVIDVRVYDTFEEML   64 (111)
T ss_pred             CCCCCCEEEEcCCeeEEEEEEEeehhHHHHHH
Confidence            589999999997         34677787763


No 14 
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle depende
Probab=53.59  E-value=13  Score=25.22  Aligned_cols=17  Identities=18%  Similarity=-0.005  Sum_probs=14.6

Q ss_pred             CCCCCcEEEEEc-CCCCc
Q psy13877         45 GSSPAQVVKLTN-PPVQT   61 (114)
Q Consensus        45 ~~kPGD~V~lTG-p~p~t   61 (114)
                      .+++||+|.+.| +..|.
T Consensus        47 ~l~~Gd~V~v~G~v~~y~   64 (91)
T cd04482          47 LLIPGDEVTVYGSVRPGT   64 (91)
T ss_pred             CCCCCCEEEEEEEEecCC
Confidence            378999999999 77776


No 15 
>CHL00143 rpl3 ribosomal protein L3; Validated
Probab=39.04  E-value=44  Score=26.76  Aligned_cols=38  Identities=16%  Similarity=0.277  Sum_probs=27.9

Q ss_pred             eeeceEeeeeccCCCCCCCC-----CCCCCcEEEEEcCCCCcce
Q psy13877         25 FVKFQELKVQEHTSNQPLQM-----GSSPAQVVKLTNPPVQTGQ   63 (114)
Q Consensus        25 F~dfQeVrIQE~peeVP~G~-----~~kPGD~V~lTGp~p~tgf   63 (114)
                      +..+-|+|+.+ .+++|.|+     -..|||.|+++|..---||
T Consensus        77 ~r~l~Efrv~~-~~~~~vG~~l~v~~F~~Gq~VDV~g~sKGKGF  119 (207)
T CHL00143         77 LKYLKEFRVKS-SEEFEVGQPLTVDAFSVGQLVNVSGKSIGKGF  119 (207)
T ss_pred             ceEEEEEEcCC-cccCCCCCEEEhhhccCCCEEEEEEEecCCcc
Confidence            34567889977 45599999     4799999999994333344


No 16 
>PF00970 FAD_binding_6:  Oxidoreductase FAD-binding domain;  InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain.  To date, the 3D-structures of the flavoprotein domain of Zea mays (Maize) nitrate reductase [] and of pig NADH:cytochrome b5 reductase [] have been solved. The overall fold is similar to that of ferredoxin:NADP+ reductase []: the FAD-binding domain (N-terminal) has the topology of an anti-parallel beta-barrel, while the NAD(P)-binding domain (C-terminal) has the topology of a classical pyridine dinucleotide-binding fold (i.e. a central parallel beta-sheet flanked by 2 helices on each side).; PDB: 1JB9_A 3LVB_A 3LO8_A 1FRN_A 1FND_A 1BX1_A 1FNC_A 1FNB_A 1BX0_A 1FRQ_A ....
Probab=38.85  E-value=20  Score=23.34  Aligned_cols=14  Identities=21%  Similarity=0.387  Sum_probs=12.3

Q ss_pred             CCCCCcEEEEEcCC
Q psy13877         45 GSSPAQVVKLTNPP   58 (114)
Q Consensus        45 ~~kPGD~V~lTGp~   58 (114)
                      .+++||+|.|.||.
T Consensus        81 ~l~~Gd~v~i~gP~   94 (99)
T PF00970_consen   81 QLKPGDEVEIRGPY   94 (99)
T ss_dssp             TSCTTSEEEEEEEE
T ss_pred             hCCCCCEEEEEEcc
Confidence            68999999999963


No 17 
>PRK03760 hypothetical protein; Provisional
Probab=38.37  E-value=22  Score=25.54  Aligned_cols=11  Identities=0%  Similarity=-0.033  Sum_probs=9.0

Q ss_pred             CCCCCcEEEEE
Q psy13877         45 GSSPAQVVKLT   55 (114)
Q Consensus        45 ~~kPGD~V~lT   55 (114)
                      +++|||+|.+.
T Consensus       105 gi~~Gd~v~~~  115 (117)
T PRK03760        105 KVEVGDEIEWI  115 (117)
T ss_pred             CCCCCCEEEEe
Confidence            58999999763


No 18 
>PRK11507 ribosome-associated protein; Provisional
Probab=36.03  E-value=29  Score=23.42  Aligned_cols=14  Identities=14%  Similarity=0.162  Sum_probs=11.8

Q ss_pred             CCCCCCCcEEEEEc
Q psy13877         43 QMGSSPAQVVKLTN   56 (114)
Q Consensus        43 G~~~kPGD~V~lTG   56 (114)
                      |..++|||.|.|.|
T Consensus        50 gkKl~~GD~V~~~g   63 (70)
T PRK11507         50 RCKIVAGQTVSFAG   63 (70)
T ss_pred             CCCCCCCCEEEECC
Confidence            33799999999987


No 19 
>smart00276 GLECT Galectin. Galectin - galactose-binding lectin
Probab=34.91  E-value=60  Score=22.79  Aligned_cols=30  Identities=17%  Similarity=0.137  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCCcEEEEEc-CCCC-cceeeeeecC
Q psy13877         39 NQPLQMGSSPAQVVKLTN-PPVQ-TGQKMIVLTN   70 (114)
Q Consensus        39 eVP~G~~~kPGD~V~lTG-p~p~-tgf~a~~l~n   70 (114)
                      .+|.|  .+||+.|.|+| +.+. ..|.--..++
T Consensus         4 ~lp~~--l~~G~~i~i~G~~~~~~~~F~inl~~~   35 (128)
T smart00276        4 PIPGG--LKPGQTLTVRGIVLPDAKRFSINLLTG   35 (128)
T ss_pred             cCCCC--CCCCCEEEEEEEECCCCCEEEEEeecC
Confidence            35555  89999999999 4443 3454433333


No 20 
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=32.78  E-value=27  Score=24.39  Aligned_cols=12  Identities=42%  Similarity=0.830  Sum_probs=10.9

Q ss_pred             CCCCCcEEEEEc
Q psy13877         45 GSSPAQVVKLTN   56 (114)
Q Consensus        45 ~~kPGD~V~lTG   56 (114)
                      +++|||+|.|+=
T Consensus        54 gak~GdvVkIvR   65 (80)
T COG2012          54 GAKPGDVVKIVR   65 (80)
T ss_pred             cCCCCcEEEEEe
Confidence            599999999987


No 21 
>PF12249 AftA_C:  Arabinofuranosyltransferase A C terminal;  InterPro: IPR020959 The arabinofuranosyltransferase enzyme AftA is involved in cell wall arabinan biosynthesis in bacteria []. It catalyses the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. As this enzyme is important for cell growth and is found in some important pathogens, such as Mycobacterium tuberculosis, it represents a potential target for the devlopment of new antibacterial drugs. This entry represents the C-terminal domain of AftA.; GO: 0016757 transferase activity, transferring glycosyl groups, 0044038 cell wall macromolecule biosynthetic process, 0005886 plasma membrane, 0016021 integral to membrane
Probab=32.49  E-value=52  Score=26.06  Aligned_cols=42  Identities=26%  Similarity=0.347  Sum_probs=34.1

Q ss_pred             ccCCCCCCCC---------------CCCCCcEEEEEc------CCCCcceeeeeecCCCCCcch
Q psy13877         35 EHTSNQPLQM---------------GSSPAQVVKLTN------PPVQTGQKMIVLTNNSNPPAL   77 (114)
Q Consensus        35 E~peeVP~G~---------------~~kPGD~V~lTG------p~p~tgf~a~~l~n~v~~~~~   77 (114)
                      |+.+..|+|.               +-.|-|.|.||-      -.||-||.++- +.+.||++.
T Consensus        22 ~RaDr~P~~a~~yY~~id~~I~~~tG~~~~~tVvLT~d~~FlsyyPY~gFQalT-sHYANPLae   84 (178)
T PF12249_consen   22 ERADRRPPDAERYYPEIDAAIREQTGRPPDDTVVLTDDYSFLSYYPYWGFQALT-SHYANPLAE   84 (178)
T ss_pred             cccccCCCchHHhHHHHHHHHHHhcCCCCCCeEEEeccccceEecccccccccc-hhhcCchhh
Confidence            5677788887               347889999998      67999999987 677888874


No 22 
>PF08021 FAD_binding_9:  Siderophore-interacting FAD-binding domain;  InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins. This entry includes the vibriobactin utilization protein ViuB, which is involved in the removal of iron from iron-vibriobactin complexes, as well as several hypothetical proteins.; PDB: 2GPJ_A.
Probab=31.47  E-value=25  Score=24.81  Aligned_cols=14  Identities=29%  Similarity=0.525  Sum_probs=9.3

Q ss_pred             CCCCCcEEEEEcCC
Q psy13877         45 GSSPAQVVKLTNPP   58 (114)
Q Consensus        45 ~~kPGD~V~lTGp~   58 (114)
                      .++|||.|.|+||.
T Consensus       101 ~A~pGd~v~v~gP~  114 (117)
T PF08021_consen  101 SARPGDRVGVTGPR  114 (117)
T ss_dssp             H--TT-EEEEEEEE
T ss_pred             hCCCCCEEEEeCCC
Confidence            58999999999953


No 23 
>PF02769 AIRS_C:  AIR synthase related protein, C-terminal domain;  InterPro: IPR010918 This entry includes Hydrogen expression/formation protein, HypE, which may be involved in the maturation of NifE hydrogenase; AIR synthase and FGAM synthase, which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP.; PDB: 2Z1F_A 2Z1E_A 2YXZ_D 2V9Y_A 2HS0_A 2HRU_A 2HS3_A 3D54_A 1VK3_A 2HS4_A ....
Probab=30.89  E-value=32  Score=23.85  Aligned_cols=11  Identities=18%  Similarity=0.516  Sum_probs=10.2

Q ss_pred             CCCcEEEEEcC
Q psy13877         47 SPAQVVKLTNP   57 (114)
Q Consensus        47 kPGD~V~lTGp   57 (114)
                      +|||.|.++|+
T Consensus         1 k~GD~i~~~g~   11 (153)
T PF02769_consen    1 KPGDLIIVTGS   11 (153)
T ss_dssp             STTEEEEEECS
T ss_pred             CCCCEEEEECC
Confidence            69999999996


No 24 
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more compl
Probab=30.53  E-value=1.5e+02  Score=18.83  Aligned_cols=28  Identities=4%  Similarity=0.049  Sum_probs=18.5

Q ss_pred             ceEeeeeccCCCCCCCCCCCCCcEEEEEc
Q psy13877         28 FQELKVQEHTSNQPLQMGSSPAQVVKLTN   56 (114)
Q Consensus        28 fQeVrIQE~peeVP~G~~~kPGD~V~lTG   56 (114)
                      -++|.+-...+.+|. +.+.+||.|.++|
T Consensus        44 v~~l~~~~g~~~~~v-~~~~aGdI~~i~g   71 (83)
T cd04088          44 VGRLLRMHGKKQEEV-EEAGAGDIGAVAG   71 (83)
T ss_pred             eeEEEEEcCCCceEC-CEeCCCCEEEEEC
Confidence            444554545545554 3588999999999


No 25 
>KOG3416|consensus
Probab=30.14  E-value=32  Score=26.13  Aligned_cols=13  Identities=23%  Similarity=0.460  Sum_probs=11.5

Q ss_pred             CCCCCCcEEEEEc
Q psy13877         44 MGSSPAQVVKLTN   56 (114)
Q Consensus        44 ~~~kPGD~V~lTG   56 (114)
                      ...+|||.|.|||
T Consensus        60 ~~~~PGDIirLt~   72 (134)
T KOG3416|consen   60 CLIQPGDIIRLTG   72 (134)
T ss_pred             cccCCccEEEecc
Confidence            3579999999999


No 26 
>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism]
Probab=29.20  E-value=41  Score=28.39  Aligned_cols=23  Identities=22%  Similarity=0.534  Sum_probs=16.9

Q ss_pred             CCCCCcEEEEEc--CCCCcceeeee
Q psy13877         45 GSSPAQVVKLTN--PPVQTGQKMIV   67 (114)
Q Consensus        45 ~~kPGD~V~lTG--p~p~tgf~a~~   67 (114)
                      .++|||.|.+||  -.+..|+..+.
T Consensus       147 gAkpGD~v~vtG~lG~saagl~ll~  171 (317)
T COG0611         147 GAKPGDLVAVTGTLGRSAAGLELLL  171 (317)
T ss_pred             CCCCCCEEEEcCCCchhHHHHHHHh
Confidence            699999999999  44555554443


No 27 
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.
Probab=28.58  E-value=1.2e+02  Score=23.78  Aligned_cols=19  Identities=21%  Similarity=0.433  Sum_probs=15.2

Q ss_pred             CCCCCC------CCCCCcEEEEEcC
Q psy13877         39 NQPLQM------GSSPAQVVKLTNP   57 (114)
Q Consensus        39 eVP~G~------~~kPGD~V~lTGp   57 (114)
                      .+|.|.      .+++||.|.|+||
T Consensus       116 ~~~~G~~S~~L~~l~~Gd~v~i~gP  140 (283)
T cd06188         116 DIPPGIGSSYIFNLKPGDKVTASGP  140 (283)
T ss_pred             CCCCceehhHHhcCCCCCEEEEECc
Confidence            366666      5899999999994


No 28 
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=28.40  E-value=66  Score=21.02  Aligned_cols=18  Identities=17%  Similarity=0.296  Sum_probs=13.2

Q ss_pred             CCCCCcEEEEEc-CCCCcc
Q psy13877         45 GSSPAQVVKLTN-PPVQTG   62 (114)
Q Consensus        45 ~~kPGD~V~lTG-p~p~tg   62 (114)
                      .+++||+|.++| +....|
T Consensus        43 ~l~~Gd~V~v~G~v~~~~G   61 (73)
T cd04487          43 EVEVGDIVRVTGEVEPRDG   61 (73)
T ss_pred             CCCCCCEEEEEEEEecCCe
Confidence            378999999999 433444


No 29 
>PF07425 Pardaxin:  Pardaxin;  InterPro: IPR009990 This family consists of several Pardaxin proteins. Pardaxin, a 33-amino-acid pore-forming polypeptide toxin isolated from the Red Sea Moses sole Pardachirus marmoratus, has a helix-hinge-helix structure. This is a common structural motif found both in antibacterial peptides that can act selectively on bacterial membranes (e.g., cecropin), and in cytotoxic peptides that can lyse both mammalian and bacterial cells (e.g., melittin). Pardaxin possesses a high antibacterial activity with a significantly reduced haemolytic activity towards human red blood cells compared with melittin []. Pardaxin has also been found to have a shark repellent action [].; GO: 0005576 extracellular region; PDB: 1XC0_A 2KNS_A.
Probab=27.66  E-value=25  Score=20.61  Aligned_cols=12  Identities=42%  Similarity=0.745  Sum_probs=9.2

Q ss_pred             chhhhhhhCCCC
Q psy13877         93 IASKLMKKGGQD  104 (114)
Q Consensus        93 ~~~~~~~~~~~~  104 (114)
                      .|++|-++|||.
T Consensus        22 vgsalsssggqe   33 (33)
T PF07425_consen   22 VGSALSSSGGQE   33 (33)
T ss_dssp             HHHHCTTTCCG-
T ss_pred             HHHHHhcccCCC
Confidence            478888999984


No 30 
>KOG1749|consensus
Probab=27.38  E-value=61  Score=24.66  Aligned_cols=32  Identities=13%  Similarity=-0.011  Sum_probs=24.9

Q ss_pred             CCCCcEEEEEc---------CCCCcceeeeeecCCCCCcchh
Q psy13877         46 SSPAQVVKLTN---------PPVQTGQKMIVLTNNSNPPALE   78 (114)
Q Consensus        46 ~kPGD~V~lTG---------p~p~tgf~a~~l~n~v~~~~~~   78 (114)
                      +.--|+|.+.|         -.|-..|+.++++| |+++++-
T Consensus        94 ieendevlv~gfgrkg~avgdipgvrfkvvkv~~-vsl~alf  134 (143)
T KOG1749|consen   94 IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVSG-VSLLALF  134 (143)
T ss_pred             eccCCeeeeeccCccCccccCCCceEEEEEEEcC-cChhhhh
Confidence            45678888887         46777799999999 8887653


No 31 
>PF07287 DUF1446:  Protein of unknown function (DUF1446);  InterPro: IPR010839 This family consists of several bacterial and plant proteins of around 400 residues in length. The function of this family is unknown.
Probab=27.22  E-value=80  Score=27.05  Aligned_cols=27  Identities=15%  Similarity=0.412  Sum_probs=18.9

Q ss_pred             eeeeceEeeeeccCCCCCCCCCCCCCcEEEEEc----CCCCc
Q psy13877         24 KFVKFQELKVQEHTSNQPLQMGSSPAQVVKLTN----PPVQT   61 (114)
Q Consensus        24 kF~dfQeVrIQE~peeVP~G~~~kPGD~V~lTG----p~p~t   61 (114)
                      .-.||-.++++|..+           |+|.|+|    |.|++
T Consensus       277 vv~D~~~v~~~q~~~-----------~rVrVsG~~g~p~p~t  307 (362)
T PF07287_consen  277 VVLDLSNVRFEQVGE-----------DRVRVSGARGRPPPPT  307 (362)
T ss_pred             EEEEeeeeEEEEeCC-----------CeEEEECCccCCCCCc
Confidence            556677777776543           7899999    66664


No 32 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=27.07  E-value=20  Score=24.98  Aligned_cols=11  Identities=18%  Similarity=0.344  Sum_probs=5.3

Q ss_pred             CCCCCcEEEEE
Q psy13877         45 GSSPAQVVKLT   55 (114)
Q Consensus        45 ~~kPGD~V~lT   55 (114)
                      ++++||+|.+.
T Consensus        97 ~i~~Gd~v~~~  107 (108)
T PF02643_consen   97 GIKVGDRVRIE  107 (108)
T ss_dssp             T--TT-EEE--
T ss_pred             CCCCCCEEEec
Confidence            68999999863


No 33 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=26.82  E-value=56  Score=22.13  Aligned_cols=18  Identities=33%  Similarity=0.637  Sum_probs=12.1

Q ss_pred             CCCCCcEEEEEcCCCCcc
Q psy13877         45 GSSPAQVVKLTNPPVQTG   62 (114)
Q Consensus        45 ~~kPGD~V~lTGp~p~tg   62 (114)
                      +++|||+|.|+-..+-+|
T Consensus        48 g~k~GdVvkI~R~S~taG   65 (74)
T PF01191_consen   48 GAKPGDVVKIIRKSETAG   65 (74)
T ss_dssp             T--TTSEEEEEEEETTTS
T ss_pred             CCCCCCEEEEEecCCCCC
Confidence            699999999998444444


No 34 
>PF02080 TrkA_C:  TrkA-C domain;  InterPro: IPR006037 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus. The domain is prevalent among prokaryotic K+ channels, and also found in eukaryotic, high-conductance Ca2+-activated K+ channels (BK channels) [, , ]. Largely involved in redox-linked regulation of potassium channels, the N-terminal part of the RCK domain is predicted to be an active dehydrogenase at least in some cases []. Some have a conserved sequence motif (G-x-G-x-x-G-x(n)-[DE]) for NAD+ binding [], but others do not, reflecting the diversity of ligands for RCK domains. The C-terminal part is less conserved, being absent in some channels, such as the kefC antiporter from Escherichia coli. It is predicted to bind unidentified ligands and to regulate sulphate, sodium and other transporters. The X-ray structure of several RCK domains has been solved [, , ]. It reveals an alpha-beta fold similar to dehydrogenase enzymes. The domain forms a homodimer, producing a cleft between two lobes. It has a composite structure, with an N-terminal (RCK-N), and a C-terminal (RCK-C) subdomain. The RCK-N subdomain forms a Rossmann fold with two alpha helices on one side of a six stranded parallel beta sheet and three alpha helices on the other side. The RCK-C subdomain is an all-beta-strand fold. It forms an extention of the dimer interface and further stabilises the RCK homodimer [, , ]. Ca2+ is a ligand that opens the channel in a concentration-dependent manner. Two Ca2+ ions are located at the base of a cleft between two RCK domains, coordinated by the carboxylate groups of two glutamate residues, and by an aspartate residue [, , ]. RCK domains occur in at least five different contexts:   As a single domain on the C terminus of some K+ channels (for example, many prokaryotic K+ channels).  As two tandem RCK domains on the C terminus of some transporters that form gating rings (for example, eukaryotic BK channels). The gating ring has an arrangement of eight identical RCK domains, one from each of the four pore-forming subunits and four from the intracellular solution. As two domains, one at the N terminus and another at the C terminus of transporter (for example, the prokaryotic trk system potassium uptake protein A). As a soluble protein (not part of a K+ channel) consisting of two tandem RCK domains. As a soluble protein consisting of a single RCK domain.   This entry represents the C-terminal subdomain of RCK.; GO: 0008324 cation transmembrane transporter activity, 0006813 potassium ion transport; PDB: 2BKP_A 1VCT_A 2BKO_A 2BKN_A 3L4B_C 2FY8_D 2AEF_A 1LNQ_E 3RBX_C 3KXD_A ....
Probab=26.82  E-value=36  Score=20.73  Aligned_cols=17  Identities=6%  Similarity=-0.013  Sum_probs=11.6

Q ss_pred             CCCCC-CCCCCcEEEEEc
Q psy13877         40 QPLQM-GSSPAQVVKLTN   56 (114)
Q Consensus        40 VP~G~-~~kPGD~V~lTG   56 (114)
                      +|.++ .+++||.+.+.|
T Consensus        41 ~p~~~~~l~~gD~l~v~g   58 (71)
T PF02080_consen   41 IPDGDTVLQAGDILIVVG   58 (71)
T ss_dssp             S--TT-BE-TTEEEEEEE
T ss_pred             CCCCCCEECCCCEEEEEE
Confidence            45555 689999999988


No 35 
>PRK08051 fre FMN reductase; Validated
Probab=26.45  E-value=80  Score=23.89  Aligned_cols=30  Identities=3%  Similarity=0.140  Sum_probs=19.2

Q ss_pred             CCCCCcEEEEEcC------CCCcceeeeeecCCCCC
Q psy13877         45 GSSPAQVVKLTNP------PVQTGQKMIVLTNNSNP   74 (114)
Q Consensus        45 ~~kPGD~V~lTGp------~p~tgf~a~~l~n~v~~   74 (114)
                      .++|||+|.|.||      .+..+-+.+.+++++=.
T Consensus        79 ~l~~G~~v~v~gP~G~~~~~~~~~~~~vliagG~Gi  114 (232)
T PRK08051         79 RILKDGEIEVDIPHGDAWLREESERPLLLIAGGTGF  114 (232)
T ss_pred             HcCCCCEEEEEcCCCceEccCCCCCcEEEEecCcCc
Confidence            5799999999993      12223345666665543


No 36 
>KOG2241|consensus
Probab=25.79  E-value=56  Score=27.11  Aligned_cols=14  Identities=29%  Similarity=0.489  Sum_probs=12.1

Q ss_pred             CCCCCCCCCcEEEEEc
Q psy13877         41 PLQMGSSPAQVVKLTN   56 (114)
Q Consensus        41 P~G~~~kPGD~V~lTG   56 (114)
                      |.|  +.|||+|+|.|
T Consensus       186 P~g--s~pGdRv~feg  199 (255)
T KOG2241|consen  186 PAG--SKPGDRVTFEG  199 (255)
T ss_pred             CCC--CCCCCeeeecC
Confidence            455  88999999999


No 37 
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=24.97  E-value=55  Score=21.36  Aligned_cols=12  Identities=17%  Similarity=0.515  Sum_probs=10.2

Q ss_pred             CCCCCcEEEEEc
Q psy13877         45 GSSPAQVVKLTN   56 (114)
Q Consensus        45 ~~kPGD~V~lTG   56 (114)
                      ++++||.|.|-+
T Consensus        53 G~~~GD~V~Ig~   64 (69)
T TIGR03595        53 GAKDGDTVRIGD   64 (69)
T ss_pred             CCCCCCEEEEcc
Confidence            599999998864


No 38 
>PF13567 DUF4131:  Domain of unknown function (DUF4131)
Probab=24.79  E-value=1.2e+02  Score=20.39  Aligned_cols=11  Identities=9%  Similarity=0.392  Sum_probs=10.4

Q ss_pred             CCCCcEEEEEc
Q psy13877         46 SSPAQVVKLTN   56 (114)
Q Consensus        46 ~kPGD~V~lTG   56 (114)
                      ..|||++.++|
T Consensus       129 l~~Gd~i~~~g  139 (176)
T PF13567_consen  129 LQPGDRIRVRG  139 (176)
T ss_pred             cCCCCEEEEEE
Confidence            68999999999


No 39 
>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism]
Probab=24.61  E-value=91  Score=25.84  Aligned_cols=34  Identities=12%  Similarity=0.346  Sum_probs=21.5

Q ss_pred             CCCCCcEEEEEcC----CCCcce-eeeeecCCCCCcchh
Q psy13877         45 GSSPAQVVKLTNP----PVQTGQ-KMIVLTNNSNPPALE   78 (114)
Q Consensus        45 ~~kPGD~V~lTGp----~p~tgf-~a~~l~n~v~~~~~~   78 (114)
                      .++|||.+.|.||    .|...+ ..+.+.-...+|+..
T Consensus       121 ~a~~GD~l~i~GP~g~~~p~~~~~~~lLigDetAlPAIa  159 (265)
T COG2375         121 TAQPGDTLTIMGPRGSLVPPEAADWYLLIGDETALPAIA  159 (265)
T ss_pred             hCCCCCEEEEeCCCCCCCCCCCcceEEEeccccchHHHH
Confidence            6999999999993    333443 344445555555543


No 40 
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hy
Probab=24.51  E-value=91  Score=23.67  Aligned_cols=35  Identities=11%  Similarity=0.325  Sum_probs=23.2

Q ss_pred             CCCCCcEEEEEcCC-----CCcceeeeeecCCCCCcchhh
Q psy13877         45 GSSPAQVVKLTNPP-----VQTGQKMIVLTNNSNPPALEE   79 (114)
Q Consensus        45 ~~kPGD~V~lTGp~-----p~tgf~a~~l~n~v~~~~~~~   79 (114)
                      .++|||.|.+.||.     +...-+.+.+++.+-++.++.
T Consensus        98 ~l~~Gd~v~v~gP~G~~~~~~~~~~~vlia~GtGi~p~~~  137 (235)
T cd06193          98 SAQPGDTLGIAGPGGSFLPPPDADWYLLAGDETALPAIAA  137 (235)
T ss_pred             hCCCCCEEEEECCCCCCCCCCCcceEEEEeccchHHHHHH
Confidence            68999999999931     111224577777777666444


No 41 
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]
Probab=24.45  E-value=1.4e+02  Score=21.83  Aligned_cols=40  Identities=10%  Similarity=0.159  Sum_probs=29.6

Q ss_pred             CccceEEEecCceeeeceEeeeeccCCCCCCCC--CCCCCcEEEE
Q psy13877         12 SGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQM--GSSPAQVVKL   54 (114)
Q Consensus        12 s~G~l~L~~r~SkF~dfQeVrIQE~peeVP~G~--~~kPGD~V~l   54 (114)
                      +.|+|+++.....|..+-+=++-=.+|.   |+  .++|||.+.|
T Consensus        53 TpG~~r~~y~~~E~chil~G~v~~T~d~---Ge~v~~~aGD~~~~   94 (116)
T COG3450          53 TPGKFRVTYDEDEFCHILEGRVEVTPDG---GEPVEVRAGDSFVF   94 (116)
T ss_pred             cCccceEEcccceEEEEEeeEEEEECCC---CeEEEEcCCCEEEE
Confidence            5789999999999998766554444442   44  5789999887


No 42 
>PF14801 GCD14_N:  tRNA methyltransferase complex GCD14 subunit N-term; PDB: 1I9G_A.
Probab=24.42  E-value=50  Score=21.49  Aligned_cols=14  Identities=29%  Similarity=0.335  Sum_probs=8.9

Q ss_pred             CCCCcEEEEEcCCC
Q psy13877         46 SSPAQVVKLTNPPV   59 (114)
Q Consensus        46 ~kPGD~V~lTGp~p   59 (114)
                      .++||+|+||-|.-
T Consensus         6 f~~GdrVQlTD~Kg   19 (54)
T PF14801_consen    6 FRAGDRVQLTDPKG   19 (54)
T ss_dssp             --TT-EEEEEETT-
T ss_pred             CCCCCEEEEccCCC
Confidence            57999999998553


No 43 
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=23.73  E-value=62  Score=22.31  Aligned_cols=15  Identities=27%  Similarity=0.614  Sum_probs=12.2

Q ss_pred             CCCCCcEEEEEcCCC
Q psy13877         45 GSSPAQVVKLTNPPV   59 (114)
Q Consensus        45 ~~kPGD~V~lTGp~p   59 (114)
                      +++|||+|.|+=..+
T Consensus        51 g~k~GdVvkI~R~S~   65 (79)
T PRK09570         51 GAKPGDVIKIVRKSP   65 (79)
T ss_pred             CCCCCCEEEEEECCC
Confidence            599999999987433


No 44 
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date oligomerize to bring together four OB folds in their active state. The majority (e.g. Escherichia coli SSB) have a single OB fold per monomer, which oligomerize to form a homotetramer. However, Deinococcus and Thermus SSB proteins have two OB folds per monomer, which oligomerize to form a homodimer. Mycobacterium tuberculosis SSB varies in quaternary structure from E. coli SSB. It forms a dimer of dimers having a unique dimer interface, which lends the protein greater stability. Included in this group are OB folds similar to Escherichia coli PriB. E.coli PriB is homodimeric with each monomer having a single OB fold. It does not appear to form higher order oligomers. PriB is an essential protein for the replication restart
Probab=23.33  E-value=54  Score=21.06  Aligned_cols=12  Identities=8%  Similarity=0.003  Sum_probs=11.2

Q ss_pred             CCCCCcEEEEEc
Q psy13877         45 GSSPAQVVKLTN   56 (114)
Q Consensus        45 ~~kPGD~V~lTG   56 (114)
                      .+++||.|.|+|
T Consensus        61 ~~~kG~~V~v~G   72 (100)
T cd04496          61 YLKKGDLVYVEG   72 (100)
T ss_pred             HhCCCCEEEEEE
Confidence            489999999999


No 45 
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=22.47  E-value=2.2e+02  Score=18.15  Aligned_cols=27  Identities=15%  Similarity=0.043  Sum_probs=17.8

Q ss_pred             eEeeeeccCCCCCCCCCCCCCcEEEEEc
Q psy13877         29 QELKVQEHTSNQPLQMGSSPAQVVKLTN   56 (114)
Q Consensus        29 QeVrIQE~peeVP~G~~~kPGD~V~lTG   56 (114)
                      ++|.+-...+.+|. +.+.+||.|.+.|
T Consensus        45 ~~l~~~~g~~~~~v-~~~~aGdI~~i~g   71 (83)
T cd04092          45 SRLLQPFADQYQEI-PSLSAGNIGVITG   71 (83)
T ss_pred             eEEEEEECCCceEC-CeeCCCCEEEEEC
Confidence            34444444555554 3588999999998


No 46 
>PRK14105 selenophosphate synthetase; Provisional
Probab=22.15  E-value=63  Score=26.45  Aligned_cols=22  Identities=23%  Similarity=0.283  Sum_probs=15.9

Q ss_pred             CCCCCCCCCCCcEEEEEcCCCC
Q psy13877         39 NQPLQMGSSPAQVVKLTNPPVQ   60 (114)
Q Consensus        39 eVP~G~~~kPGD~V~lTGp~p~   60 (114)
                      ++.....++|||.|.+||+.=.
T Consensus       158 ~~i~r~ga~~GD~I~vTg~lG~  179 (345)
T PRK14105        158 DILTKAGAKEGDVLILTKPLGT  179 (345)
T ss_pred             ceeeCCCCCCCCEEEEeCCChH
Confidence            3333446999999999995544


No 47 
>PRK06863 single-stranded DNA-binding protein; Provisional
Probab=22.03  E-value=69  Score=24.57  Aligned_cols=44  Identities=11%  Similarity=0.031  Sum_probs=29.5

Q ss_pred             CCCCCcEEEEEc---CCCCc---c---eeeeeecCCCCCcchhhhhhhcCCccc
Q psy13877         45 GSSPAQVVKLTN---PPVQT---G---QKMIVLTNNSNPPALEEKKFDRGIYNN   89 (114)
Q Consensus        45 ~~kPGD~V~lTG---p~p~t---g---f~a~~l~n~v~~~~~~~~~~~~g~~~~   89 (114)
                      .++.||.|.|+|   ...|+   |   +..-+++..|..+..+.+. ..+||++
T Consensus        69 ~LkKGs~V~VeGrL~~r~w~DkdG~~r~~~eI~a~~i~~L~~r~~~-~~~~~~~  121 (168)
T PRK06863         69 YLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRNQR-NAGGYGN  121 (168)
T ss_pred             HCCCCCEEEEEEEEEeCCccCCCCCEEEEEEEEEeEEEECCCCCcc-ccccccc
Confidence            489999999999   33332   3   5666777778777666543 4456644


No 48 
>TIGR00621 ssb single stranded DNA-binding protein (ssb). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.81  E-value=72  Score=23.82  Aligned_cols=35  Identities=14%  Similarity=0.088  Sum_probs=23.2

Q ss_pred             CCCCCcEEEEEc---CCCC---cc---eeeeeecCCCCCcchhh
Q psy13877         45 GSSPAQVVKLTN---PPVQ---TG---QKMIVLTNNSNPPALEE   79 (114)
Q Consensus        45 ~~kPGD~V~lTG---p~p~---tg---f~a~~l~n~v~~~~~~~   79 (114)
                      .++.||.|.|+|   ...|   .|   +..-+++.+|..+....
T Consensus        68 ~l~KG~~V~V~G~L~~~~~~~kdG~~~~~~ev~a~~i~~L~~~~  111 (164)
T TIGR00621        68 YLKKGSLVYVEGRLRTRKWEDQNGQKRSKTEIIADNVQLLDLLG  111 (164)
T ss_pred             hCCCCCEEEEEEEEEeceEECCCCcEEEEEEEEEEEEeeccccC
Confidence            479999999999   3333   33   45566667675555443


No 49 
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.
Probab=20.98  E-value=1.2e+02  Score=22.58  Aligned_cols=28  Identities=14%  Similarity=0.392  Sum_probs=18.2

Q ss_pred             CCCCcEEEEEcC------CCCcceeeeeecCCCC
Q psy13877         46 SSPAQVVKLTNP------PVQTGQKMIVLTNNSN   73 (114)
Q Consensus        46 ~kPGD~V~lTGp------~p~tgf~a~~l~n~v~   73 (114)
                      ++|||.|.|.||      .+...-+.+.+++++-
T Consensus        75 ~~~g~~v~v~gP~G~~~~~~~~~~~illIagG~G  108 (232)
T cd06190          75 LEPGDELELDGPYGLAYLRPDEDRDIVCIAGGSG  108 (232)
T ss_pred             CCCCCEEEEECCcccceecCCCCCcEEEEeeCcC
Confidence            689999999993      1222335566676553


No 50 
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.
Probab=20.85  E-value=1.1e+02  Score=22.67  Aligned_cols=13  Identities=15%  Similarity=0.360  Sum_probs=11.3

Q ss_pred             CCCCCcEEEEEcC
Q psy13877         45 GSSPAQVVKLTNP   57 (114)
Q Consensus        45 ~~kPGD~V~lTGp   57 (114)
                      .++|||.|.|.||
T Consensus        75 ~l~~G~~v~i~gP   87 (224)
T cd06189          75 ELKENGLVRIEGP   87 (224)
T ss_pred             hccCCCEEEEecC
Confidence            3799999999993


No 51 
>PF02874 ATP-synt_ab_N:  ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f;  InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The F-ATPases (or F1F0-ATPases), V-ATPases (or V1V0-ATPases) and A-ATPases (or A1A0-ATPases) are composed of two linked complexes: the F1, V1 or A1 complex contains the catalytic core that synthesizes/hydrolyses ATP, and the F0, V0 or A0 complex that forms the membrane-spanning pore. The F-, V- and A-ATPases all contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, ]. In F-ATPases, there are three copies each of the alpha and beta subunits that form the catalytic core of the F1 complex, while the remaining F1 subunits (gamma, delta, epsilon) form part of the stalks. There is a substrate-binding site on each of the alpha and beta subunits, those on the beta subunits being catalytic, while those on the alpha subunits are regulatory. The alpha and beta subunits form a cylinder that is attached to the central stalk. The alpha/beta subunits undergo a sequence of conformational changes leading to the formation of ATP from ADP, which are induced by the rotation of the gamma subunit, itself driven by the movement of protons through the F0 complex C subunit []. In V- and A-ATPases, the alpha/A and beta/B subunits of the V1 or A1 complex are homologous to the alpha and beta subunits in the F1 complex of F-ATPases, except that the alpha subunit is catalytic and the beta subunit is regulatory. The structure of the alpha and beta subunits is almost identical. Each subunit consists of a N-terminal beta-barrel, a central domain containing the nucleotide-binding site and a C-terminal alpha bundle domain []. This entry represents the N-terminal domain, which forms a closed beta-barrel with Greek-key topology. ; GO: 0046933 hydrogen ion transporting ATP synthase activity, rotational mechanism, 0046961 proton-transporting ATPase activity, rotational mechanism, 0015992 proton transport, 0046034 ATP metabolic process, 0016469 proton-transporting two-sector ATPase complex; PDB: 1W0K_A 1H8H_B 2WSS_A 1EFR_A 2JIZ_H 1E1Q_A 2V7Q_B 1E79_B 1E1R_C 2XND_C ....
Probab=20.69  E-value=69  Score=19.76  Aligned_cols=12  Identities=33%  Similarity=0.429  Sum_probs=10.8

Q ss_pred             CCCCCcEEEEEc
Q psy13877         45 GSSPAQVVKLTN   56 (114)
Q Consensus        45 ~~kPGD~V~lTG   56 (114)
                      ++++|++|..||
T Consensus        58 Gl~~G~~V~~tG   69 (69)
T PF02874_consen   58 GLSRGTEVRFTG   69 (69)
T ss_dssp             TSBTTCEEEEEE
T ss_pred             CCCCCCEEEcCc
Confidence            689999999997


No 52 
>cd02691 PurM-like2 AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function. The family of PurM related proteins includes Hydrogen expression/formation protein HypE, AIR synthases, FGAM synthase and Selenophosphate synthetase (SelD). They all contain two conserved domains and seem to dimerize. The N-terminal domain forms the dimer interface and is a putative ATP binding domain.
Probab=20.61  E-value=71  Score=26.65  Aligned_cols=16  Identities=13%  Similarity=0.287  Sum_probs=13.1

Q ss_pred             CCCCCCcEEEEEcCCC
Q psy13877         44 MGSSPAQVVKLTNPPV   59 (114)
Q Consensus        44 ~~~kPGD~V~lTGp~p   59 (114)
                      +.++|||.|.+||+..
T Consensus       158 ~gA~pGD~I~vtg~~G  173 (346)
T cd02691         158 KNAEPGDLILMTEGAG  173 (346)
T ss_pred             cCCCCCCEEEEECCcc
Confidence            4699999999999443


No 53 
>TIGR03625 L3_bact 50S ribosomal protein L3, bacterial. This model describes bacterial (and mitochondrial and chloroplast) class of ribosomal protein L3. A separate model describes the archaeal form, where both belong to Pfam family pfam00297. The name is phrased to meet the needs of bacterial genome annotation. Organellar forms typically will have transit peptides, N-terminal to the region modeled here.
Probab=20.45  E-value=1.2e+02  Score=24.21  Aligned_cols=38  Identities=16%  Similarity=0.121  Sum_probs=27.2

Q ss_pred             eeeceEeeeeccCCCCCCCC-----CCCCCcEEEEEcCCCCcce
Q psy13877         25 FVKFQELKVQEHTSNQPLQM-----GSSPAQVVKLTNPPVQTGQ   63 (114)
Q Consensus        25 F~dfQeVrIQE~peeVP~G~-----~~kPGD~V~lTGp~p~tgf   63 (114)
                      +....|+++.+. +.+|.|+     -..||+.|+++|..---||
T Consensus        74 kr~l~Efrv~~~-~~~~~G~~l~v~~F~~G~~VDV~g~skGKGF  116 (202)
T TIGR03625        74 KRHLREFRVDDL-EGYEVGDEITVDIFEAGQKVDVTGTSKGKGF  116 (202)
T ss_pred             CcEEEEEEcCCc-ccCCCCCEEEeeeecCCCEEEEEEEEcCCcc
Confidence            344578888664 5699999     4799999999993333344


No 54 
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=20.31  E-value=70  Score=21.76  Aligned_cols=12  Identities=8%  Similarity=-0.072  Sum_probs=9.9

Q ss_pred             CCCCCcEEEEEc
Q psy13877         45 GSSPAQVVKLTN   56 (114)
Q Consensus        45 ~~kPGD~V~lTG   56 (114)
                      .++|||+|..+|
T Consensus        37 ~L~~Gd~VvT~g   48 (84)
T TIGR00739        37 SLKKGDKVLTIG   48 (84)
T ss_pred             hCCCCCEEEECC
Confidence            378999998877


Done!