Diaphorina citri psyllid: psy13897

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
NHLCFHSILSDAHLAAIVNAKEESTSLLRNFYKSEDIFLDMFQFEYDQIQKKPLNVEYLMMDSKMLLPPAGTPLTGNNPLTALTVS
ccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHccccccccccccccccccccccccccc
*HLCFHSILSDAHLAAIVNAKEESTSLLRNFYKSEDIFLDMFQFEYDQIQKKPLNVEYLMMDSKMLLPPAGTPLTGNNPLTALTV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NHLCFHSILSDAHLAAIVNAKEESTSLLRNFYKSEDIFLDMFQFEYDQIQKKPLNVEYLMMDSKMLLPPAGTPLTGNNPLTALTVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein CLEC16A confidentQ2KHT3
Protein CLEC16A confidentQ80U30

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted