Diaphorina citri psyllid: psy13908

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MVRKLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTYNKLSRLIRTLAQKIKDLDPKDPFRVESSAKLLEKLYLMGLIRTKWDLENCNKVTASSFCKRRLPVVMYRNKMVQQLRLATQFIEQAHVRVGPELEGDMIEGS
ccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccccHHHHHHHHHHHcHHHHHHHHHcccEEEcccccccccccc
**RKLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTYNKLSRLIRTLAQKIKDLDPKDPFRVESSAKLLEKLYLMGLIRTKWDLENCNKVTASSFCKRRLPVVMYRNKMVQQLRLATQFIEQAHVRVGPELEGD*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRKLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTYNKLSRLIRTLAQKIKDLDPKDPFRVESSAKLLEKLYLMGLIRTKWDLENCNKVTASSFCKRRLPVVMYRNKMVQQLRLATQFIEQAHVRVGPELEGDMIEGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U3 small nucleolar ribonucleoprotein protein IMP3 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.confidentQ921Y2
U3 small nucleolar ribonucleoprotein protein IMP3 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.confidentQ3T0M3
U3 small nucleolar ribonucleoprotein protein IMP3 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.confidentQ9NV31

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034457 [CC]Mpp10 complexprobableGO:0030686, GO:0031974, GO:0030684, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0019843 [MF]rRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain C
Confidence level:very confident
Coverage over the Query: 1-148
View the alignment between query and template
View the model in PyMOL