Diaphorina citri psyllid: psy13912


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MVRKLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTAGFKPNPVPPELTVLLHFYLCFAINRIWKL
cccHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccc
***KLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTAGFKPNPVPPELTVLLHFYLCFAINRIWK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRKLKYHEQKLLKKVDFISWEADNNLHEVKIMRRFGIQKRQDYTTAGFKPNPVPPELTVLLHFYLCFAINRIWKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U3 small nucleolar ribonucleoprotein protein IMP3 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.confidentQ921Y2
U3 small nucleolar ribonucleoprotein protein IMP3 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.confidentQ3T0M3
U3 small nucleolar ribonucleoprotein protein imp3 Component of the U3 small nucleolar ribonucleoprotein. Required for the early cleavages at sites A0, A1 and A2 during 18S ribosomal pre-RNA processing.confidentO13835

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0034457 [CC]Mpp10 complexprobableGO:0030686, GO:0031974, GO:0030684, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain C
Confidence level:confident
Coverage over the Query: 10-57
View the alignment between query and template
View the model in PyMOL