Query         psy13914
Match_columns 87
No_of_seqs    57 out of 59
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 23:42:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13914.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13914hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2717|consensus              100.0 5.6E-50 1.2E-54  314.9   8.1   87    1-87    200-294 (313)
  2 PF03643 Vps26:  Vacuolar prote 100.0 1.1E-32 2.3E-37  211.9   9.1   81    2-82    188-270 (275)
  3 KOG3063|consensus               96.6  0.0087 1.9E-07   48.3   7.0   72    8-79    201-274 (301)
  4 PF09064 Tme5_EGF_like:  Thromb  54.9     6.7 0.00015   22.9   0.9   13   22-34     19-31  (34)
  5 PF01826 TIL:  Trypsin Inhibito  44.5      18 0.00038   20.9   1.6   18   17-34     29-46  (55)
  6 COG4888 Uncharacterized Zn rib  35.4      15 0.00032   26.1   0.4   16   57-72     18-33  (104)
  7 PF08004 DUF1699:  Protein of u  33.3      17 0.00037   26.7   0.4   29   19-47     42-77  (131)
  8 PF02752 Arrestin_C:  Arrestin   30.3 1.4E+02   0.003   18.5   7.4   24    5-28     31-54  (136)
  9 PF12662 cEGF:  Complement Clr-  23.8      43 0.00094   17.7   0.9   11   22-32      3-13  (24)
 10 PF08290 Hep_core_N:  Hepatitis  22.8      30 0.00065   19.3   0.1   10   62-71     12-21  (27)
 11 PF00399 PIR:  Yeast PIR protei  22.0      33 0.00072   17.6   0.2    7   40-46      6-12  (18)
 12 KOG0443|consensus               21.7      54  0.0012   30.3   1.5   26   51-78    612-637 (827)
 13 COG1644 RPB10 DNA-directed RNA  20.7      26 0.00056   22.9  -0.5   16   56-71      1-17  (63)
 14 PF01194 RNA_pol_N:  RNA polyme  20.5      36 0.00078   21.8   0.1   17   56-72      1-18  (60)

No 1  
>KOG2717|consensus
Probab=100.00  E-value=5.6e-50  Score=314.87  Aligned_cols=87  Identities=56%  Similarity=0.993  Sum_probs=85.4

Q ss_pred             CeeeecCCCceeEEEEEEEEeeeeeCCceeecccceeeEEEeeCcccCCCccCeEEEeeeeeccCccCccceEEEEEe--
Q psy13914          1 IVIEQTELPIKSVELQLVRVETCGCAEGYSRDATEIQNIQIGEGNVFTGIPIPIYMVFPRLFTCPTLITSNFKIGERL--   78 (87)
Q Consensus         1 l~ve~s~~pIkSIelQLvRVEt~~~~eg~~reaTEIQniQIadGdVcr~l~IPiymvfPRlftCPt~~t~~FkveFev--   78 (87)
                      |+||+|+++|+|||+||+|||||||+|||++||||||+|||||||||||+++||||+|||||||||+.|+||||||||  
T Consensus       200 ltVe~seaaI~Sie~qLvRVEtcgc~Egy~~dateIQsiQIADGdVcr~l~lPIymvlPRLftCPtl~t~nFkvEFevni  279 (313)
T KOG2717|consen  200 LTVEASEAAITSIEIQLVRVETCGCGEGYVTDATEIQSIQIADGDVCRNLTLPIYMVLPRLFTCPTLFTGNFKVEFEVNI  279 (313)
T ss_pred             EEEEeeccceeEEEEEEEEEEEeecccceecccceeeeEEeccCccccCCceeEEEEechhhcCCceeccccEEEEEEEE
Confidence            589999999999999999999999999999999999999999999999999999999999999999999999999999  


Q ss_pred             ------ceeeeccCC
Q psy13914         79 ------DHYTTKNLK   87 (87)
Q Consensus        79 ------~~liteNfp   87 (87)
                            ||.++||||
T Consensus       280 ~v~fk~d~~~~enf~  294 (313)
T KOG2717|consen  280 TVSFKSDLAKAENFA  294 (313)
T ss_pred             EEEEccchhhccCCc
Confidence                  799999996


No 2  
>PF03643 Vps26:  Vacuolar protein sorting-associated protein 26 ;  InterPro: IPR005377  The movement of lipid and protein components between intracellular organelles requires the regulated interactions of many molecules. Vacuolar protein sorting-associated protein (Vps)5 is a yeast protein that is a subunit of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Sorting nexin (SNX) 1 and SNX2 are its mammalian orthologs []. To carry out its biological functions, Vps5 forms the retromer complex with at least four other proteins: Vps17, Vps26, Vps29, and Vps35 []. This family of Vps26-proteins also contains Down syndrome critical region 3/A.; GO: 0007034 vacuolar transport, 0030904 retromer complex; PDB: 3LHA_A 3LH9_A 2R51_A 3LH8_B 2FAU_A.
Probab=99.98  E-value=1.1e-32  Score=211.93  Aligned_cols=81  Identities=44%  Similarity=0.790  Sum_probs=66.0

Q ss_pred             eeeecCCCceeEEEEEEEEeeeeeCCceeecccceeeEEEeeCcccCCCccCeEEEeeeeeccCccCc--cceEEEEEec
Q psy13914          2 VIEQTELPIKSVELQLVRVETCGCAEGYSRDATEIQNIQIGEGNVFTGIPIPIYMVFPRLFTCPTLIT--SNFKIGERLD   79 (87)
Q Consensus         2 ~ve~s~~pIkSIelQLvRVEt~~~~eg~~reaTEIQniQIadGdVcr~l~IPiymvfPRlftCPt~~t--~~FkveFev~   79 (87)
                      .+..++.+||||||||+|+|||||++|+++|+|+||++||+|||+|||..|||||+|||||+|||+.+  +.|||+|+++
T Consensus       188 ~f~lv~~kIk~~elqLiR~Et~g~~~~~~~e~t~i~~~eImDG~p~rge~IPirl~l~~l~l~Pt~~~~~~~FsV~y~ln  267 (275)
T PF03643_consen  188 YFLLVRIKIKSMELQLIRVETCGCGENYAKESTEIQKIEIMDGAPCRGESIPIRLFLPRLFLCPTYKNVNNKFSVEYELN  267 (275)
T ss_dssp             EEEEESS-EEEEEEEEEEEEEECECCCEEEEEEEEEEEEEESS---TT-EEEEEEECCCT-----EEEECTTEEEEEEEE
T ss_pred             EEEEEeecceEEEEEEEEEEEEecCCcccccceEEEEEEeecCCccccceeeEEEEcCCcccCCcchhcCCcEEEEEEEE
Confidence            46778899999999999999999999999999999999999999999999999999999999999994  5699999997


Q ss_pred             eee
Q psy13914         80 HYT   82 (87)
Q Consensus        80 ~li   82 (87)
                      -.+
T Consensus       268 lvl  270 (275)
T PF03643_consen  268 LVL  270 (275)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            543


No 3  
>KOG3063|consensus
Probab=96.61  E-value=0.0087  Score=48.27  Aligned_cols=72  Identities=24%  Similarity=0.397  Sum_probs=62.3

Q ss_pred             CCceeEEEEEEEEeeeeeCCceeecccceeeEEEeeCcccCCCccCeEEEeeeeeccCccC--ccceEEEEEec
Q psy13914          8 LPIKSVELQLVRVETCGCAEGYSRDATEIQNIQIGEGNVFTGIPIPIYMVFPRLFTCPTLI--TSNFKIGERLD   79 (87)
Q Consensus         8 ~pIkSIelQLvRVEt~~~~eg~~reaTEIQniQIadGdVcr~l~IPiymvfPRlftCPt~~--t~~FkveFev~   79 (87)
                      .+||-.||+++|-|+.|.+-....+..-|..-+|-||.-.||=.|||-|.+--.=--||+.  .+.|||..=++
T Consensus       201 ikIk~Mel~iikrEstG~gpn~~~e~eTiakyeIMDGapvrGEsIPiRlFLagYdlTPtmrdinkkFsVkyyLn  274 (301)
T KOG3063|consen  201 IKIKHMELSIIKRESTGTGPNTYVETETIAKYEIMDGAPVRGESIPIRLFLAGYDLTPTMRDINKKFSVKYYLN  274 (301)
T ss_pred             EEeeeeEEEEEEeecccCCCcceeccceeeeEEeccCCCcCCCeeeeEEEecccCCCcchhhhcceeeeeeEEE
Confidence            4689999999999999998887778888999999999999999999988877776778887  77788876663


No 4  
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=54.93  E-value=6.7  Score=22.86  Aligned_cols=13  Identities=46%  Similarity=0.915  Sum_probs=10.8

Q ss_pred             eeeeCCceeeccc
Q psy13914         22 TCGCAEGYSRDAT   34 (87)
Q Consensus        22 t~~~~eg~~reaT   34 (87)
                      +|-|+|||..|..
T Consensus        19 ~C~CPeGyIlde~   31 (34)
T PF09064_consen   19 QCFCPEGYILDEG   31 (34)
T ss_pred             ceeCCCceEecCC
Confidence            6899999998753


No 5  
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=44.48  E-value=18  Score=20.94  Aligned_cols=18  Identities=39%  Similarity=0.689  Sum_probs=14.2

Q ss_pred             EEEEeeeeeCCceeeccc
Q psy13914         17 LVRVETCGCAEGYSRDAT   34 (87)
Q Consensus        17 LvRVEt~~~~eg~~reaT   34 (87)
                      ..-++.|.|.+||+++..
T Consensus        29 ~~C~~gC~C~~G~v~~~~   46 (55)
T PF01826_consen   29 EPCVEGCFCPPGYVRNDN   46 (55)
T ss_dssp             SS-ESEEEETTTEEEETT
T ss_pred             CCCCccCCCCCCeeEcCC
Confidence            346788999999999876


No 6  
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=35.42  E-value=15  Score=26.10  Aligned_cols=16  Identities=38%  Similarity=0.783  Sum_probs=11.5

Q ss_pred             EeeeeeccCccCccce
Q psy13914         57 VFPRLFTCPTLITSNF   72 (87)
Q Consensus        57 vfPRlftCPt~~t~~F   72 (87)
                      .+|+.||||---.-+-
T Consensus        18 ~L~k~FtCp~Cghe~v   33 (104)
T COG4888          18 VLPKTFTCPRCGHEKV   33 (104)
T ss_pred             cCCceEecCccCCeee
Confidence            5899999996544433


No 7  
>PF08004 DUF1699:  Protein of unknown function (DUF1699);  InterPro: IPR012546 This family contains many archaeal proteins which have very conserved sequences.
Probab=33.31  E-value=17  Score=26.65  Aligned_cols=29  Identities=24%  Similarity=0.457  Sum_probs=19.7

Q ss_pred             EEeeeeeCCceeecc-------cceeeEEEeeCccc
Q psy13914         19 RVETCGCAEGYSRDA-------TEIQNIQIGEGNVF   47 (87)
Q Consensus        19 RVEt~~~~eg~~rea-------TEIQniQIadGdVc   47 (87)
                      |++...++.-|-+-.       =+.|.||+-+|||+
T Consensus        42 ~lk~iqiP~SY~~t~Sksi~mfL~mqgI~LleGDVw   77 (131)
T PF08004_consen   42 NLKAIQIPPSYYKTLSKSIKMFLEMQGIELLEGDVW   77 (131)
T ss_pred             CCeEEeCChHHHHHHhHHHHHHHHhcCceeeccccc
Confidence            344555555444332       37899999999999


No 8  
>PF02752 Arrestin_C:  Arrestin (or S-antigen), C-terminal domain;  InterPro: IPR011022 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The C-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=30.33  E-value=1.4e+02  Score=18.55  Aligned_cols=24  Identities=29%  Similarity=0.365  Sum_probs=18.1

Q ss_pred             ecCCCceeEEEEEEEEeeeeeCCc
Q psy13914          5 QTELPIKSVELQLVRVETCGCAEG   28 (87)
Q Consensus         5 ~s~~pIkSIelQLvRVEt~~~~eg   28 (87)
                      .|...|++|.+.|+|.-+.....+
T Consensus        31 ~s~~~i~~I~v~L~~~~~~~~~~~   54 (136)
T PF02752_consen   31 QSKKKIKKIKVSLVERITYKAKGG   54 (136)
T ss_dssp             -SSSEEEEEEEEEEEEEEE-SS--
T ss_pred             CCCCEEEEEEEEEEEEEEEEEeec
Confidence            567899999999999999987765


No 9  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=23.78  E-value=43  Score=17.70  Aligned_cols=11  Identities=45%  Similarity=1.168  Sum_probs=9.0

Q ss_pred             eeeeCCceeec
Q psy13914         22 TCGCAEGYSRD   32 (87)
Q Consensus        22 t~~~~eg~~re   32 (87)
                      +|.|..||...
T Consensus         3 ~C~C~~Gy~l~   13 (24)
T PF12662_consen    3 TCSCPPGYQLS   13 (24)
T ss_pred             EeeCCCCCcCC
Confidence            58999999854


No 10 
>PF08290 Hep_core_N:  Hepatitis core protein, putative zinc finger;  InterPro: IPR013195 This entry represent a short region found at the N terminus of some viral capsid (HBcAg) proteins from various Hepatitis B virus (HBV), which is a major human pathogen. The conservation of four Cys residues suggests that this region acts as a zinc binding domain. Hepatitis virus is composed of an outer envelope of host-derived lipid containing the surface proteins, and an inner protein capsid that contains genomic DNA. The capsid is composed of a single polypeptide, HBcAg, also known as the core antigen. The capsid has a 5-helical fold, where two long helices form a hairpin that dimerises into a 4-helical bundle []; this fold is unusual for icosahedral viruses. The monomer fold is stabilised by a hydrophobic core that is highly conserved among human viral variants. The capsid is assembled from dimers via interactions involving a highly conserved arginine-rich region near the C terminus. This viral capsid acts as a core antigen, the major immunodominant region lying at the tips of the alpha-helical hairpins that form spikes on the capsid surface. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005198 structural molecule activity, 0009405 pathogenesis
Probab=22.84  E-value=30  Score=19.35  Aligned_cols=10  Identities=40%  Similarity=0.860  Sum_probs=7.5

Q ss_pred             eccCccCccc
Q psy13914         62 FTCPTLITSN   71 (87)
Q Consensus        62 ftCPt~~t~~   71 (87)
                      -+|||.++..
T Consensus        12 cscpt~qask   21 (27)
T PF08290_consen   12 CSCPTVQASK   21 (27)
T ss_pred             ccCCcchhhh
Confidence            4799988764


No 11 
>PF00399 PIR:  Yeast PIR protein repeat;  InterPro: IPR000420 A number of yeast cell wall glycoproteins are characterised by the presence of tandem repeats of a region of 18 to 19 residues [, ].; GO: 0005199 structural constituent of cell wall, 0005618 cell wall
Probab=21.96  E-value=33  Score=17.58  Aligned_cols=7  Identities=57%  Similarity=1.256  Sum_probs=5.5

Q ss_pred             EEeeCcc
Q psy13914         40 QIGEGNV   46 (87)
Q Consensus        40 QIadGdV   46 (87)
                      ||.||.+
T Consensus         6 QI~DGQi   12 (18)
T PF00399_consen    6 QIGDGQI   12 (18)
T ss_pred             cccCCce
Confidence            7888865


No 12 
>KOG0443|consensus
Probab=21.68  E-value=54  Score=30.27  Aligned_cols=26  Identities=27%  Similarity=0.347  Sum_probs=18.7

Q ss_pred             ccCeEEEeeeeeccCccCccceEEEEEe
Q psy13914         51 PIPIYMVFPRLFTCPTLITSNFKIGERL   78 (87)
Q Consensus        51 ~IPiymvfPRlftCPt~~t~~FkveFev   78 (87)
                      .-+.--.-||||+|- ..++-|.++ |+
T Consensus       612 ~~~~~~~~PrLF~Cs-~~~g~f~~~-EI  637 (827)
T KOG0443|consen  612 LEEKPERDPRLFSCS-NKTGSFVVE-EI  637 (827)
T ss_pred             ccccCCCCCcEEEEE-ecCCcEEEE-Ee
Confidence            335555779999995 467788888 44


No 13 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=20.73  E-value=26  Score=22.93  Aligned_cols=16  Identities=38%  Similarity=0.895  Sum_probs=11.1

Q ss_pred             EEee-eeeccCccCccc
Q psy13914         56 MVFP-RLFTCPTLITSN   71 (87)
Q Consensus        56 mvfP-RlftCPt~~t~~   71 (87)
                      |++| |=|||-+..+.-
T Consensus         1 MiiPiRCFsCGkvi~~~   17 (63)
T COG1644           1 MIIPVRCFSCGKVIGHK   17 (63)
T ss_pred             CCCceEeecCCCCHHHH
Confidence            4455 889998876543


No 14 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=20.49  E-value=36  Score=21.79  Aligned_cols=17  Identities=41%  Similarity=0.954  Sum_probs=9.6

Q ss_pred             EEee-eeeccCccCccce
Q psy13914         56 MVFP-RLFTCPTLITSNF   72 (87)
Q Consensus        56 mvfP-RlftCPt~~t~~F   72 (87)
                      |++| |=|||-......+
T Consensus         1 MiiPVRCFTCGkvi~~~~   18 (60)
T PF01194_consen    1 MIIPVRCFTCGKVIGNKW   18 (60)
T ss_dssp             ---SSS-STTTSBTCGHH
T ss_pred             CCCceecCCCCCChhHhH
Confidence            4555 8899988876543


Done!