Diaphorina citri psyllid: psy13925


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MPRPCRDTYGDQKPPYSYISLTAMAIWSSPEKMLPLSDIYRFIADRFPYYRRNTQRWQNSLRHNLSFNDCFVKIPRRPDRPGKGAYWALHPNALDMFENGSLLRRRRRFKLMKSDKDKLENELAALANVNRIYLSSQSPTTSDDFEHPESPISNFDEDEEIDVIHDFSPKTLDYSLKNLNYSPKSIDKSPEPMESSHAKPFDFSINSNSLISSSHLEQHTKLSEPSDSEIKKSSTSVKRPFDIENLISTDSFTSQAHCLSPYLLQQPLMFLPPPGLLSHPSYFPTQPNLLRFPPLSYPSIPSSLLHPFSLKSCSTFLAATISPWFSLGILPSLCVCNIDQWTNP
ccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHccccccccEEccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************YSYISLTAMAIWSSPEKMLPLSDIYRFIADRFPYYRRNTQRWQNSLRHNLSFNDCFVKIPRRPDRPGKGAYWALHPNALDMFENGSLLRRR**F*************************************************************************************************************************************IENLISTDSFTSQAHCLSPYLLQQPLMFLPPPGLLSHPSYFPTQPNLLRFPPLSYPSIPSSLLHPFSLKSCSTFLAATISPWFSLGILPSLCVCNIDQW***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRPCRDTYGDQKPPYSYISLTAMAIWSSPEKMLPLSDIYRFIADRFPYYRRNTQRWQNSLRHNLSFNDCFVKIPRRPDRPGKGAYWALHPNALDMFENGSLLRRRRRxxxxxxxxxxxxxxxxxxxxxNRIYLSSQSPTTSDDFEHPESPISNFDEDEEIDVIHDFSPKTLDYSLKNLNYSPKSIDKSPEPMESSHAKPFDFSINSNSLISSSHLEQHTKLSEPSDSEIKKSSTSVKRPFDIENLISTDSFTSQAHCLSPYLLQQPLMFLPPPGLLSHPSYFPTQPNLLRFPPLSYPSIPSSLLHPFSLKSCSTFLAATISPWFSLGILPSLCVCNIDQWTNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein lin-31 Lin-31 regulates how vulval precursor cells choose their fate. It helps specify three alternative cell fates in vulval development.confidentP34683
Fork head domain-containing protein FD4 Involved in development during embryogenesis.confidentP32028

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0061041 [BP]regulation of wound healingprobableGO:0008150, GO:0065007, GO:0080134, GO:0048583, GO:0050789
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0000981 [MF]sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0022414 [BP]reproductive processprobableGO:0008150, GO:0000003
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HFH, chain A
Confidence level:very confident
Coverage over the Query: 12-101
View the alignment between query and template
View the model in PyMOL