Query         psy13939
Match_columns 86
No_of_seqs    139 out of 595
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 15:27:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13939.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13939hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3573|consensus               99.9 6.1E-22 1.3E-26  147.4   5.1   74    7-86    208-285 (300)
  2 smart00115 CASc Caspase, inter  99.8   4E-21 8.6E-26  139.5   6.8   63    8-70    150-216 (241)
  3 cd00032 CASc Caspase, interleu  99.8 6.2E-20 1.3E-24  133.0   5.7   63    8-70    154-220 (243)
  4 PF00656 Peptidase_C14:  Caspas  98.0   1E-05 2.2E-10   56.7   5.2   56   12-67    163-230 (248)
  5 PF03500 Cellsynth_D:  Cellulos  81.9     1.3 2.8E-05   30.8   2.3   35   36-70      2-36  (144)
  6 cd00512 MM_CoA_mutase Coenzyme  81.5    0.78 1.7E-05   36.3   1.3   21   31-51    319-339 (399)
  7 cd03677 MM_CoA_mutase_beta Coe  80.9    0.84 1.8E-05   36.3   1.3   21   31-51    344-364 (424)
  8 cd03679 MM_CoA_mutase_alpha_li  77.1     1.3 2.8E-05   36.4   1.3   22   30-51    384-405 (536)
  9 PF01642 MM_CoA_mutase:  Methyl  76.7     1.2 2.6E-05   36.3   1.0   22   30-51    363-384 (516)
 10 TIGR00642 mmCoA_mut_beta methy  76.6     1.3 2.9E-05   36.8   1.3   21   31-51    380-400 (619)
 11 PRK09426 methylmalonyl-CoA mut  76.5     1.4 2.9E-05   37.3   1.3   21   31-51    391-411 (714)
 12 TIGR00641 acid_CoA_mut_N methy  76.0     1.4 3.1E-05   36.1   1.3   22   30-51    368-389 (528)
 13 cd03681 MM_CoA_mutase_MeaA Coe  75.4     1.5 3.3E-05   34.9   1.3   22   30-51    326-347 (407)
 14 cd03680 MM_CoA_mutase_ICM_like  74.5     1.6 3.6E-05   35.8   1.3   22   30-51    388-409 (538)
 15 cd03678 MM_CoA_mutase_1 Coenzy  73.0     1.9 4.1E-05   35.2   1.3   22   30-51    414-435 (495)
 16 COG1884 Sbm Methylmalonyl-CoA   62.7     3.7 7.9E-05   34.0   1.0   21   31-51    391-411 (548)
 17 PF09003 Phage_integ_N:  Bacter  55.0     2.1 4.5E-05   26.7  -1.3   15   24-38     26-40  (75)
 18 PF12109 CXCR4_N:  CXCR4 Chemok  51.6      10 0.00022   20.2   1.2   19    2-20     13-31  (33)
 19 PF08388 GIIM:  Group II intron  44.5      61  0.0013   18.9   4.1   29   39-67      5-33  (80)
 20 cd07357 HN_L-whirlin_R2_like S  43.8      16 0.00034   23.1   1.4   27   37-67     40-66  (81)
 21 PF12475 Amdo_NSP:  Amdovirus n  42.0      20 0.00043   20.6   1.5   14   36-49     16-29  (48)
 22 PF05066 HARE-HTH:  HB1, ASXL,   41.5      45 0.00097   19.4   3.2   37   38-74      3-39  (72)
 23 cd08326 CARD_CASP9 Caspase act  40.1      36 0.00078   21.1   2.7   26   33-59     58-83  (84)
 24 KOG2424|consensus               34.4      57  0.0012   23.8   3.2   29   32-60    148-178 (195)
 25 PF04819 DUF716:  Family of unk  34.0      18 0.00039   24.3   0.6   15   34-48     73-87  (137)
 26 PF12993 DUF3877:  Domain of un  32.6      64  0.0014   23.1   3.2   28   33-60     91-119 (175)
 27 PF00806 PUF:  Pumilio-family R  30.7      46   0.001   16.5   1.7   13   33-45     13-25  (35)
 28 COG1955 FlaJ Archaeal flagella  28.1      68  0.0015   26.7   3.1   39   23-61    351-395 (527)
 29 smart00025 Pumilio Pumilio-lik  27.0      50  0.0011   15.6   1.5   15   33-47     13-27  (36)
 30 PF15463 ECM11:  Extracellular   25.9      76  0.0017   21.2   2.6   35   33-67     76-111 (139)
 31 PF04895 DUF651:  Archaeal prot  25.3 1.3E+02  0.0028   19.9   3.5   42   22-67     42-85  (110)
 32 PF12887 SICA_alpha:  SICA extr  25.0 1.9E+02  0.0042   20.2   4.6   41   33-73    109-152 (184)
 33 PF12221 HflK_N:  Bacterial mem  21.8      98  0.0021   17.0   2.1   18   51-68     19-36  (42)
 34 PRK05883 acyl carrier protein;  21.1 1.3E+02  0.0028   18.6   2.8   24   24-47      1-28  (91)
 35 cd08332 CARD_CASP2 Caspase act  21.1      87  0.0019   19.5   2.0   27   34-61     63-89  (90)
 36 cd08802 Death_UNC5B Death doma  20.9   1E+02  0.0022   19.4   2.2   19   39-57     63-81  (84)
 37 PF12022 DUF3510:  Domain of un  20.4 1.8E+02  0.0038   19.1   3.5   42   31-72     29-77  (125)
 38 KOG4417|consensus               20.2      57  0.0012   24.5   1.2   24   22-48     87-110 (261)
 39 PHA02593 62 clamp loader small  20.2      98  0.0021   22.5   2.3   37   24-63     14-50  (191)

No 1  
>KOG3573|consensus
Probab=99.85  E-value=6.1e-22  Score=147.44  Aligned_cols=74  Identities=35%  Similarity=0.614  Sum_probs=64.0

Q ss_pred             ccccccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhhhccCCCcccccc
Q psy13939          7 LSKMYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQ   82 (86)
Q Consensus         7 ~~~~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~~s~~~~~~~~~~   82 (86)
                      .....+.||.+||||    |+|||+||||+..||||||+||++|.++++. ||++||++||++|..  ...   -+..++
T Consensus       208 ~~~~~~~ips~aD~L~~~st~~g~~s~R~~~~gsw~Iq~Lc~~~~~~~~~-~l~~ll~~v~~~~~~--~~~---~~~~~~  281 (300)
T KOG3573|consen  208 DDDATYKIPSEADFLVSYSTTPGYVSWRDPTKGSWFIQSLCEVLQEYAKS-DLLDLLTEVNRKVSF--SFD---VPGGNA  281 (300)
T ss_pred             ccchhccCccccceeEeeecCCCceeeecCCCceeeHHHHHHHHHHhcch-hHHHHHHHHHHhhhc--ccc---cccccc
Confidence            345678899999999    9999999999999999999999999999998 999999999999642  121   157788


Q ss_pred             ccCC
Q psy13939         83 QKQI   86 (86)
Q Consensus        83 ~KQm   86 (86)
                      .|||
T Consensus       282 ~kq~  285 (300)
T KOG3573|consen  282 QKQM  285 (300)
T ss_pred             cccC
Confidence            8886


No 2  
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues. Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
Probab=99.84  E-value=4e-21  Score=139.54  Aligned_cols=63  Identities=43%  Similarity=0.764  Sum_probs=58.0

Q ss_pred             cccccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhh
Q psy13939          8 SKMYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDM   70 (86)
Q Consensus         8 ~~~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~   70 (86)
                      +....++|.++|+|    |+|||+|||++..||||||+||++|.+++++.||++|||+||++|+...
T Consensus       150 ~~~~~~~p~~~D~li~ysT~pG~va~r~~~~gS~fi~~L~~~l~~~~~~~~l~~ilt~V~~~V~~~~  216 (241)
T smart00115      150 DDAIYKIPVEADFLAAYSTTPGYVSWRNPTRGSWFIQSLCQVLKEYARSLDLLDILTEVNRKVAVKF  216 (241)
T ss_pred             ccccccCCCcCcEEEEEeCCCCeEeecCCCCCchHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhh
Confidence            34556899999999    9999999999999999999999999999999999999999999998643


No 3  
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs.
Probab=99.80  E-value=6.2e-20  Score=132.98  Aligned_cols=63  Identities=38%  Similarity=0.653  Sum_probs=58.1

Q ss_pred             cccccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhh
Q psy13939          8 SKMYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDM   70 (86)
Q Consensus         8 ~~~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~   70 (86)
                      ......+|.++|+|    |.|||+|||++..||||||+||++|.+++++.+|++||++||++|+...
T Consensus       154 ~~~~~~~p~~~d~lv~ysT~pG~~a~r~~~~gS~fi~~l~~~l~~~~~~~~l~~il~~V~~~V~~~~  220 (243)
T cd00032         154 DDAVQTIPVEADFLVAYSTVPGYVSWRNTKKGSWFIQSLCQVLRKYAHSLDLLDILTKVNRKVAEKF  220 (243)
T ss_pred             cccccCCCCcccEEEEecCCCCeEeecCCCCCCEeHHHHHHHHHHhCCCCcHHHHHHHHHHHHhhhh
Confidence            34567899999999    9999999999999999999999999999999999999999999998643


No 4  
>PF00656 Peptidase_C14:  Caspase domain;  InterPro: IPR011600 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of sequences represent the p20 (20kDa) and p10 (10kDa) subunits of caspases, which together form the catalytic domain of the caspase and are derived from the p45 (45 kDa) precursor (IPR002398 from INTERPRO) []. Caspases (Cysteine-dependent ASPartyl-specific proteASE) are cysteine peptidases that belong to the MEROPS peptidase family C14 (caspase family, clan CD) based on the architecture of their catalytic dyad or triad []. Caspases are tightly regulated proteins that require zymogen activation to become active, and once active can be regulated by caspase inhibitors. Activated caspases act as cysteine proteases, using the sulphydryl group of a cysteine side chain for catalysing peptide bond cleavage at aspartyl residues in their substrates. The catalytic cysteine and histidine residues are on the p20 subunit after cleavage of the p45 precursor. Caspases are mainly involved in mediating cell death (apoptosis) [, , ]. They have two main roles within the apoptosis cascade: as initiators that trigger the cell death process, and as effectors of the process itself. Caspase-mediated apoptosis follows two main pathways, one extrinsic and the other intrinsic or mitochondrial-mediated. The extrinsic pathway involves the stimulation of various TNF (tumour necrosis factor) cell surface receptors on cells targeted to die by various TNF cytokines that are produced by cells such as cytotoxic T cells. The activated receptor transmits the signal to the cytoplasm by recruiting FADD, which forms a death-inducing signalling complex (DISC) with caspase-8. The subsequent activation of caspase-8 initiates the apoptosis cascade involving caspases 3, 4, 6, 7, 9 and 10. The intrinsic pathway arises from signals that originate within the cell as a consequence of cellular stress or DNA damage. The stimulation or inhibition of different Bcl-2 family receptors results in the leakage of cytochrome c from the mitochondria, and the formation of an apoptosome composed of cytochrome c, Apaf1 and caspase-9. The subsequent activation of caspase-9 initiates the apoptosis cascade involving caspases 3 and 7, among others. At the end of the cascade, caspases act on a variety of signal transduction proteins, cytoskeletal and nuclear proteins, chromatin-modifying proteins, DNA repair proteins and endonucleases that destroy the cell by disintegrating its contents, including its DNA. The different caspases have different domain architectures depending upon where they fit into the apoptosis cascades, however they all carry the catalytic p10 and p20 subunits. Caspases can have roles other than in apoptosis, such as caspase-1 (interleukin-1 beta convertase) (3.4.22.36 from EC), which is involved in the inflammatory process. The activation of apoptosis can sometimes lead to caspase-1 activation, providing a link between apoptosis and inflammation, such as during the targeting of infected cells. Caspases may also be involved in cell differentiation [].; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 1M72_C 2NN3_C 3V4L_A 3IBF_B 2QLF_D 2QLB_C 3IBC_B 2QL9_A 3R5K_B 3H1P_A ....
Probab=98.03  E-value=1e-05  Score=56.68  Aligned_cols=56  Identities=20%  Similarity=0.195  Sum_probs=47.1

Q ss_pred             cCCCCCCccc----cCCCccccCC-CCCchHHHHHHHHHHHhcCC-------CChHHHHHHHHHHHHH
Q psy13939         12 YKFDEEDDDD----VFVSFYSWRH-PENGTWFIQCLCQELADSGT-------KLDLLSIMTRVSRRVA   67 (86)
Q Consensus        12 ~~iP~~aD~L----T~~g~~s~R~-~~~GSwFIq~Lc~vl~~~~~-------~~dl~~ilt~Vn~~Va   67 (86)
                      ...|..++++    |.+|.+||+. +..||||+++||+.|+++++       ...|.+|++.|+++|+
T Consensus       163 ~~~~~~~~~~~~~as~~~~~s~e~~~~~~g~ft~~L~~~L~~~~~~~~~~~~~~~l~~~~~~v~~~~~  230 (248)
T PF00656_consen  163 SDVPSPSGFIVLSASRPGQTSYEDSPGSGGLFTYALLEALKGNAADDPNQSWDELLEELLTEVNQKVA  230 (248)
T ss_dssp             EEEETTTSEEEEESSSTTBCEEEECTTTEEHHHHHHHHHHHHHTTTSTTCCTTSBHHHHHHHHHHHHH
T ss_pred             ccccCCCCcEEEEeccccceeecccCccCHHHHHHHHHHHHhhcccccchhHHHHHHHHHHHHHhHCC
Confidence            3444556655    9999999999 78999999999999987743       4789999999999996


No 5  
>PF03500 Cellsynth_D:  Cellulose synthase subunit D;  InterPro: IPR022798 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals. The genes that synthesize cellulose in higher plants differ greatly from the well-characterised genes found in Acetobacter and Agrobacterium spp. More correctly designated as "cellulose synthase catalytic subunits", plant cellulose synthase (CesA) proteins are integral membrane proteins, approximately 1,000 amino acids in length. There are a number of highly conserved residues, including several motifs shown to be necessary for processive glycosyltransferase activity []. An operon encoding 4 proteins required for bacterial cellulose biosynthesis (bcs) in Acetobacter xylinus (Gluconacetobacter xylinus) has been isolated via genetic complementation with strains lacking cellulose synthase activity []. Nucleotide sequence analysis showed the cellulose synthase operon to consist of 4 genes, designated bcsA, bcsB, bcsC and bcsD, all of which are required for maximal bacterial cellulose synthesis in A. xylinum. The calculated molecular mass of the protein encoded by bcsD is 17.3kDa []. The function of BcsD is unknown. This entry represents the D subunit from bacterial cellulose synthase.; PDB: 3AJ1_B 3AJ2_A 3A8E_A.
Probab=81.87  E-value=1.3  Score=30.79  Aligned_cols=35  Identities=23%  Similarity=0.472  Sum_probs=31.4

Q ss_pred             hHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhh
Q psy13939         36 TWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDM   70 (86)
Q Consensus        36 SwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~   70 (86)
                      |-|+++|++.|...+....+..+|.+|-++++.+|
T Consensus         2 ~lFl~aLa~E~~~q~g~~e~~~fLr~mG~rlA~r~   36 (144)
T PF03500_consen    2 SLFLRALAEEFEDQAGEEELRAFLRRMGERLAARH   36 (144)
T ss_dssp             HHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHCTTB
T ss_pred             hHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHhC
Confidence            67999999999999999999999999999888654


No 6  
>cd00512 MM_CoA_mutase Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM)-like family; contains proteins similar to MCM, and the large subunit of Streptomyces coenzyme B12-dependent isobutyryl-CoA mutase (ICM). MCM catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA. The reaction proceeds via radical intermediates beginning with a substrate-induced homolytic cleavage of the Co-C bond of coenzyme B12 to produce cob(II)alamin and the deoxyadenosyl radical. MCM plays an important role in the conversion of propionyl-CoA to succinyl-CoA during the degradation of propionate for the Krebs cycle. In higher animals, MCM is involved in the breakdown of odd-chain fatty acids, several amino acids, and cholesterol. Methylobacterium extorquens MCM participates in the glyoxylate regeneration pathway. In M. extorquens, MCM forms a complex with MeaB; MeaB may protect MCM from irreversible inactivation. In some bacteria, MCM is involved in the reverse metabolic reaction, the 
Probab=81.46  E-value=0.78  Score=36.25  Aligned_cols=21  Identities=24%  Similarity=0.574  Sum_probs=19.1

Q ss_pred             CCCCchHHHHHHHHHHHhcCC
Q psy13939         31 HPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      ||..|||||.+|.+-|.+.++
T Consensus       319 DPa~GSyyiE~LT~~la~~Aw  339 (399)
T cd00512         319 DPLGGSYYVEELTDSLEDAAW  339 (399)
T ss_pred             CcccCcHHHHHHHHHHHHHHH
Confidence            899999999999999988765


No 7  
>cd03677 MM_CoA_mutase_beta Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, Beta subunit-like subfamily; contains bacterial proteins similar to the beta subunit of MCMs from Propionbacterium shermanni and Streptomyces cinnamonensis, which are alpha/beta heterodimers. For P. shermanni MCM, it is known that only the alpha subunit binds coenzyme B12 and substrates. The role of the beta subunit is unclear. MCM catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA. The reaction proceeds via radical intermediates beginning with a substrate-induced homolytic cleavage of the Co-C bond of coenzyme B12 to produce cob(II)alamin and the deoxyadenosyl radical. MCM plays an important role in the conversion of propionyl-CoA to succinyl-CoA during the degradation of propionate for the Krebs cycle. Methylobacterium extorquens MCM participates in the glyoxylate regeneration pathway. In M. extorquens, MCM forms a complex with MeaB; MeaB may protect MCM from irreversib
Probab=80.86  E-value=0.84  Score=36.28  Aligned_cols=21  Identities=29%  Similarity=0.696  Sum_probs=18.9

Q ss_pred             CCCCchHHHHHHHHHHHhcCC
Q psy13939         31 HPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      ||..|||||.+|.+-|.+.++
T Consensus       344 DPagGSyyiE~LT~~la~~AW  364 (424)
T cd03677         344 DPAGGSYYIESLTDQLAEKAW  364 (424)
T ss_pred             CcccCCHHHHHHHHHHHHHHH
Confidence            899999999999999988765


No 8  
>cd03679 MM_CoA_mutase_alpha_like Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, Alpha subunit-like subfamily; contains proteins similar to the alpha subunit of Propionbacterium shermanni MCM, as well as human and E. coli MCM. Members of this subfamily contain an N-terminal MCM domain and a C-terminal coenzyme B12 binding domain. MCM catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA. The reaction proceeds via radical intermediates beginning with a substrate-induced homolytic cleavage of the Co-C bond of coenzyme B12 to produce cob(II)alamin and the deoxyadenosyl radical. MCM plays an important role in the conversion of propionyl-CoA to succinyl-CoA during the degradation of propionate for the Krebs cycle. In higher animals, MCM is involved in the breakdown of odd-chain fatty acids, several amino acids, and cholesterol. Methylobacterium extorquens MCM participates in the glyoxylate regeneration pathway. In M. extorquens, MCM forms a complex with
Probab=77.14  E-value=1.3  Score=36.42  Aligned_cols=22  Identities=23%  Similarity=0.561  Sum_probs=19.3

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||-.|||||.+|.+.|.+.++
T Consensus       384 ~DPagGSyyiE~LT~~la~~Aw  405 (536)
T cd03679         384 VDPWGGSYYMESLTDDLAEKAW  405 (536)
T ss_pred             cCcccCCHHHHHHHHHHHHHHH
Confidence            3789999999999999988764


No 9  
>PF01642 MM_CoA_mutase:  Methylmalonyl-CoA mutase;  InterPro: IPR006099 Methylmalonyl-CoA mutase (5.4.99.2 from EC) (MCM) [] is an adenosylcobalamin (vitamin B12) dependent enzyme that catalyzes the isomerization between methylmalonyl-CoA and succinyl-CoA. MCM is involved in various catabolic or biosynthetic pathways; for example in man it is involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle; while in some bacteria it is involved in the synthesis of propionate from tricarboxylic acid-cycle intermediates. Deficiency of MCM in man causes an often fatal disorder of organic acid metabolism termed methylmalonic acidemia. The sequences of eukaryotic and prokaryotic MCM are rather well conserved. In eukaryotes MCM is located in the mitochondrial matrix and is a homodimer of a polypeptide chain of about 710 amino acids. In bacteria MCM is a dimer of two non-identical, yet structurally related chains. This family also includes an Escherichia coli protein (gene sbm) whose function is not yet known. A small degree of similarity is said [] to exist between MCM and the large subunit of the adenosylcobalamin-dependent enzyme ethanolamine ammonia-lyase, but this similarity is so weak that these two type of enzymes can not be detected by a single pattern.; GO: 0016866 intramolecular transferase activity, 0031419 cobalamin binding, 0008152 metabolic process; PDB: 6REQ_C 4REQ_A 2REQ_A 1E1C_A 5REQ_A 3REQ_A 1REQ_A 7REQ_C 3BIC_A 2XIQ_A ....
Probab=76.72  E-value=1.2  Score=36.35  Aligned_cols=22  Identities=32%  Similarity=0.669  Sum_probs=19.4

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||..|||||.+|.+.|.+.++
T Consensus       363 ~DPagGSyyiE~LT~~la~~Aw  384 (516)
T PF01642_consen  363 VDPAGGSYYIEALTDELAEKAW  384 (516)
T ss_dssp             SSTTTTCHHHHHHHHHHHHHHH
T ss_pred             CCcccCCHHHHHHHHHHHHHHH
Confidence            4889999999999999998654


No 10 
>TIGR00642 mmCoA_mut_beta methylmalonyl-CoA mutase, heterodimeric type, beta chain. The adenosylcobalamin-binding, catalytic chain of methylmalonyl-CoA mutase may form homodimers, as in mitochondrion and E. coli, or heterodimers with a shorter, homologous chain that does not bind adenosylcobalamin. This model describes this non-catalytic beta chain, as found in the enzyme from Propionibacterium freudenreichii, for which the 3-dimensional structure has been solved.
Probab=76.65  E-value=1.3  Score=36.84  Aligned_cols=21  Identities=29%  Similarity=0.715  Sum_probs=18.8

Q ss_pred             CCCCchHHHHHHHHHHHhcCC
Q psy13939         31 HPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      ||.-|||||.+|.+-|.+.++
T Consensus       380 DPagGSyyIE~LT~~La~~AW  400 (619)
T TIGR00642       380 DPAGGSYYVESLTRSLADAAW  400 (619)
T ss_pred             CcCcCcHHHHHHHHHHHHHHH
Confidence            889999999999999988765


No 11 
>PRK09426 methylmalonyl-CoA mutase; Reviewed
Probab=76.48  E-value=1.4  Score=37.33  Aligned_cols=21  Identities=29%  Similarity=0.637  Sum_probs=18.8

Q ss_pred             CCCCchHHHHHHHHHHHhcCC
Q psy13939         31 HPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      ||..|||||.+|.+-|.+.++
T Consensus       391 DPagGSyyiE~LT~~la~~Aw  411 (714)
T PRK09426        391 DPWAGSYYVESLTHELAEKAW  411 (714)
T ss_pred             CcccCCHHHHHHHHHHHHHHH
Confidence            789999999999999988765


No 12 
>TIGR00641 acid_CoA_mut_N methylmalonyl-CoA mutase N-terminal domain. Methylmalonyl-CoA mutase (EC 5.4.99.2) catalyzes a reversible isomerization between L-methylmalonyl-CoA and succinyl-CoA. The enzyme uses an adenosylcobalamin cofactor. It may be a homodimer, as in mitochondrion, or a heterodimer with partially homologous beta chain that does not bind the adenosylcobalamin cofactor, as in Propionibacterium freudenreichii. The most similar archaeal sequences are separate chains, such as AF2215 abd AF2219 of Archaeoglobus fulgidus, that correspond roughly to the first 500 and last 130 residues, respectively of known methylmalonyl-CoA mutases. This model describes the N-terminal domain subfamily. In a neighbor-joining tree, AF2215 branches with a bacterial isobutyryl-CoA mutase, which is also the same length. Scoring between the noise and trusted cutoffs are the non-catalytic, partially homologous beta chains from certain heterodimeric examples of 5.4.99.2.
Probab=75.96  E-value=1.4  Score=36.07  Aligned_cols=22  Identities=18%  Similarity=0.548  Sum_probs=19.3

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||-.|||||.+|.+.|.+.++
T Consensus       368 ~DPagGSyyIE~LT~~la~~Aw  389 (528)
T TIGR00641       368 IDPLGGSYYVEWLTDDIAERAW  389 (528)
T ss_pred             cCcccCCHHHHHHHHHHHHHHH
Confidence            3789999999999999988765


No 13 
>cd03681 MM_CoA_mutase_MeaA Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, MeaA-like subfamily; contains various methylmalonyl coenzyme A (CoA) mutase (MCM)-like proteins similar to the Streptomyces cinnamonensis MeaA, Methylobacterium extorquens MeaA and Streptomyces collinus B12-dependent mutase. Members of this subfamily contain an N-terminal MCM domain and a C-terminal coenzyme B12 binding domain. S. cinnamonensis MeaA is a putative B12-dependent mutase which provides methylmalonyl-CoA precursors for the biosynthesis of the monensin polyketide via an unknown pathway. S. collinus B12-dependent mutase may be involved in a pathway for acetate assimilation.
Probab=75.43  E-value=1.5  Score=34.91  Aligned_cols=22  Identities=9%  Similarity=0.191  Sum_probs=19.5

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||-.|||||.+|.+.|.+.++
T Consensus       326 ~DP~~GSyyiE~LT~~la~~Aw  347 (407)
T cd03681         326 DDLFDGSKVVEAKVEALKEEAR  347 (407)
T ss_pred             CCcccccHHHHHHHHHHHHHHH
Confidence            4889999999999999988764


No 14 
>cd03680 MM_CoA_mutase_ICM_like Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, isobutyryl-CoA mutase (ICM)-like subfamily; contains archaeal and bacterial proteins similar to the large subunit of Streptomyces cinnamonensis coenzyme B12-dependent ICM. ICM from S. cinnamonensis is comprised of a large and a small subunit. The holoenzyme appears to be an alpha2beta2 heterotetramer with up to 2 molecules of coenzyme B12 bound. The small subunit binds coenzyme B12. ICM catalyzes the reversible rearrangement of n-butyryl-CoA to isobutyryl-CoA, intermediates in fatty acid and valine catabolism, which in S. cinnamonensis can be converted to methylmalonyl-CoA and used in polyketide synthesis.
Probab=74.51  E-value=1.6  Score=35.80  Aligned_cols=22  Identities=18%  Similarity=0.560  Sum_probs=19.3

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||-.|||||.+|.+.|.+.++
T Consensus       388 ~DPagGSyyvE~LT~~la~~Aw  409 (538)
T cd03680         388 VDPLGGSYYVEALTDEIEEEAW  409 (538)
T ss_pred             cCcccCcHHHHHHHHHHHHHHH
Confidence            3789999999999999988764


No 15 
>cd03678 MM_CoA_mutase_1 Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, unknown subfamily 1; composed of uncharacterized bacterial proteins containing a C-terminal MCM domain. MCM catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA. The reaction proceeds via radical intermediates beginning with a substrate-induced homolytic cleavage of the Co-C bond of coenzyme B12 to produce cob(II)alamin and the deoxyadenosyl radical. MCM plays an important role in the conversion of propionyl-CoA to succinyl-CoA during the degradation of propionate for the Krebs cycle. In some bacteria, MCM is involved in the reverse metabolic reaction, the rearrangement of succinyl-CoA to methylmalonyl-CoA. Members of this subfamily also contain an N-terminal coenzyme B12 binding domain followed by a domain similar to the E. coli ArgK membrane ATPase.
Probab=73.05  E-value=1.9  Score=35.24  Aligned_cols=22  Identities=18%  Similarity=0.382  Sum_probs=19.5

Q ss_pred             CCCCCchHHHHHHHHHHHhcCC
Q psy13939         30 RHPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        30 R~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      =||-.|||||.+|.+.|.+.++
T Consensus       414 ~DPagGSyyVE~LT~~la~~Aw  435 (495)
T cd03678         414 ENPLQGSFIIEELTDLVEEAVL  435 (495)
T ss_pred             cCcCCCcHHHHHHHHHHHHHHH
Confidence            4889999999999999998765


No 16 
>COG1884 Sbm Methylmalonyl-CoA mutase, N-terminal domain/subunit [Lipid metabolism]
Probab=62.70  E-value=3.7  Score=34.05  Aligned_cols=21  Identities=24%  Similarity=0.627  Sum_probs=19.1

Q ss_pred             CCCCchHHHHHHHHHHHhcCC
Q psy13939         31 HPENGTWFIQCLCQELADSGT   51 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~~~   51 (86)
                      ||--|||||..|.+-|.+.++
T Consensus       391 DP~gGSyyVE~LTd~L~e~Aw  411 (548)
T COG1884         391 DPLGGSYYVEWLTDELEEAAW  411 (548)
T ss_pred             CCCCCcchHHHHHHHHHHHHH
Confidence            889999999999999998764


No 17 
>PF09003 Phage_integ_N:  Bacteriophage lambda integrase, N-terminal domain ;  InterPro: IPR015094 The amino terminal domain of bacteriophage lambda integrase folds into a three-stranded, antiparallel beta-sheet that packs against a C-terminal alpha-helix, adopting a fold that is structurally related to the three-stranded beta-sheet family of DNA-binding domains (which includes the GCC-box DNA-binding domain and the N-terminal domain of Tn916 integrase). This domain is responsible for high-affinity binding to each of the five DNA arm-type sites and is also a context-sensitive modulator of DNA cleavage []. ; GO: 0003677 DNA binding, 0008907 integrase activity, 0015074 DNA integration; PDB: 1Z1G_B 1Z1B_A 2WCC_3 1KJK_A.
Probab=55.00  E-value=2.1  Score=26.67  Aligned_cols=15  Identities=27%  Similarity=0.656  Sum_probs=10.5

Q ss_pred             CCccccCCCCCchHH
Q psy13939         24 VSFYSWRHPENGTWF   38 (86)
Q Consensus        24 ~g~~s~R~~~~GSwF   38 (86)
                      -||+.||||.+|.+|
T Consensus        26 k~Yy~Yr~P~tGk~~   40 (75)
T PF09003_consen   26 KGYYQYRNPITGKEH   40 (75)
T ss_dssp             -SEEEEE-TTTS-EE
T ss_pred             eeEEEEecCCCCcee
Confidence            389999999998754


No 18 
>PF12109 CXCR4_N:  CXCR4 Chemokine receptor N terminal;  InterPro: IPR022726 This entry represents the N-terminal region of the CXC type 4 chemokine receptor. CXCR4 and its ligand stromal cell-derived factor-1 (a.k.a. CXCL12) are essential for proper fetal development. CXCR4 is also the major coreceptor for T-tropic strains of Human immunodeficiency virus 1, and SDF-1 inhibits HIV-1 infection. Additionally, SDF-1 and CXCR4 mediate cancer cell migration and metastasis. The N-terminal domain of most chemokine receptors is the ligand binding domain and so the N-terminal domain of CXCR4 is the binding site for SDF-1 [].; PDB: 3OE9_B 3OE0_A 3ODU_A 2K03_D 3OE8_A 2K05_D 3OE6_A 2K04_B.
Probab=51.62  E-value=10  Score=20.17  Aligned_cols=19  Identities=37%  Similarity=0.321  Sum_probs=9.6

Q ss_pred             CCcccccccccCCCCCCcc
Q psy13939          2 SGDYELSKMYYKFDEEDDD   20 (86)
Q Consensus         2 ~~~~~~~~~~~~iP~~aD~   20 (86)
                      ||||+.-..+......+||
T Consensus        13 SGDy~~~kEpCf~~eNadF   31 (33)
T PF12109_consen   13 SGDYDSYKEPCFREENADF   31 (33)
T ss_dssp             ---SSBS-S--SS-SSSST
T ss_pred             CcccccccCcccccccccc
Confidence            6899988888777777776


No 19 
>PF08388 GIIM:  Group II intron, maturase-specific domain;  InterPro: IPR013597 This region is found mainly in various bacterial and archaeal species, but a few members of this family are expressed by fungal and chlamydomonal species. It has been implicated in the binding of intron RNA during reverse transcription and splicing []. 
Probab=44.50  E-value=61  Score=18.85  Aligned_cols=29  Identities=3%  Similarity=0.008  Sum_probs=20.6

Q ss_pred             HHHHHHHHHhcCCCChHHHHHHHHHHHHH
Q psy13939         39 IQCLCQELADSGTKLDLLSIMTRVSRRVA   67 (86)
Q Consensus        39 Iq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va   67 (86)
                      .+.+-+++.......++.+++.++|..+.
T Consensus         5 ~~kik~~~~~~~~~~~~~~~i~~LN~~lr   33 (80)
T PF08388_consen    5 RRKIKEITRRRNRGKSLEELIKKLNPILR   33 (80)
T ss_pred             HHHHHHHHhCCCCCCCHHHHHHHHHHHHH
Confidence            34455555444467899999999998884


No 20 
>cd07357 HN_L-whirlin_R2_like Second harmonin_N_like domain (repeat 2) of the long isoform of whirlin, and related domains. This subgroup contains the second of two harmonin_N_like domains found in the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. The short whirlin isoform, derived from an alternative start ATG, lacks the first harmonin_N_like domain but has in common with the long isoform, this second harmonin_N_like domain (designated repeat 2, included in this subgroup) and PDZ3. This second harmonin_N_like domain is a putative protein-binding module based on its sequence similarity to the harmonin N-domain.
Probab=43.80  E-value=16  Score=23.14  Aligned_cols=27  Identities=11%  Similarity=0.284  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHhcCCCChHHHHHHHHHHHHH
Q psy13939         37 WFIQCLCQELADSGTKLDLLSIMTRVSRRVA   67 (86)
Q Consensus        37 wFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va   67 (86)
                      -|+++|++.|..+++    +++|++|...|+
T Consensus        40 alV~aL~elLnt~~K----~sLLsEiR~lI~   66 (81)
T cd07357          40 ALVMALFELLNTHEK----FSLLSEIRELIS   66 (81)
T ss_pred             HHHHHHHHHhccHHH----HHHHHHHHHhcC
Confidence            488899999988755    788888876665


No 21 
>PF12475 Amdo_NSP:  Amdovirus non-structural protein ;  InterPro: IPR020960  This domain family is found in viruses, and is approximately 50 amino acids in length. This family contains proteins of each of the three types of Amdovirus non-structural protein []. 
Probab=42.04  E-value=20  Score=20.57  Aligned_cols=14  Identities=29%  Similarity=0.610  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHHhc
Q psy13939         36 TWFIQCLCQELADS   49 (86)
Q Consensus        36 SwFIq~Lc~vl~~~   49 (86)
                      +|||..+++-|+..
T Consensus        16 ~w~~k~~n~DLa~~   29 (48)
T PF12475_consen   16 GWFLKTTNKDLALI   29 (48)
T ss_pred             HHHHHHhhHHHHHH
Confidence            69999998888764


No 22 
>PF05066 HARE-HTH:  HB1, ASXL, restriction endonuclease HTH domain;  InterPro: IPR007759 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The delta protein is a dispensable subunit of Bacillus subtilis RNA polymerase (RNAP) that has major effects on the biochemical properties of the purified enzyme. In the presence of delta, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling []. The delta protein, contains two distinct regions, an N-terminal domain and a glutamate and aspartate residue-rich C-terminal region [].; GO: 0003677 DNA binding, 0006351 transcription, DNA-dependent; PDB: 2KRC_A.
Probab=41.50  E-value=45  Score=19.42  Aligned_cols=37  Identities=14%  Similarity=0.245  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhhhccC
Q psy13939         38 FIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYN   74 (86)
Q Consensus        38 FIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~~s~~   74 (86)
                      |+.+.-++|++.+...+.-+|..++..+--....+.+
T Consensus         3 ~~eaa~~vL~~~~~pm~~~eI~~~i~~~~~~~~~~k~   39 (72)
T PF05066_consen    3 FKEAAYEVLEEAGRPMTFKEIWEEIQERGLYKKSGKT   39 (72)
T ss_dssp             HHHHHHHHHHHH-S-EEHHHHHHHHHHHHTS---GGG
T ss_pred             HHHHHHHHHHhcCCCcCHHHHHHHHHHhCCCCcccCC
Confidence            6778889999999999999999887766544433333


No 23 
>cd08326 CARD_CASP9 Caspase activation and recruitment domain of Caspase-9. Caspase activation and recruitment domain (CARD) similar to that found in caspase-9 (CASP9, MCH6, APAF3), which interacts with the CARD of apoptotic protease-activating factor 1 (APAF-1). Caspases are aspartate-specific cysteine proteases with functions in apoptosis and immune signaling. Initiator caspases are the first to be activated following death- or inflammation-inducing signals. Caspase-9 is the initiator caspase associated with the intrinsic or mitochondrial pathway of apoptosis, induced by many pro-apoptotic signals. Together with APAF-1, it forms the heptameric 'apoptosome' in response to the release of cytochrome c from mitochondria. Activated caspase-9 cleaves and activates downstream effector caspases, like caspase-3, caspase-6, and caspase-7, resulting in apoptosis. In general, CARDs are death domains (DDs) associated with caspases. They are known to be important in the signaling pathways for apopt
Probab=40.13  E-value=36  Score=21.10  Aligned_cols=26  Identities=19%  Similarity=0.406  Sum_probs=20.2

Q ss_pred             CCchHHHHHHHHHHHhcCCCChHHHHH
Q psy13939         33 ENGTWFIQCLCQELADSGTKLDLLSIM   59 (86)
Q Consensus        33 ~~GSwFIq~Lc~vl~~~~~~~dl~~il   59 (86)
                      ..|..=-.+||++|++.+ ..+|.++|
T Consensus        58 ~RG~~AF~~F~~aL~~~~-~~~LA~lL   83 (84)
T cd08326          58 TRGKQAFPAFLSALRETG-QTDLAELL   83 (84)
T ss_pred             hcCHHHHHHHHHHHHhcC-chHHHHHh
Confidence            577788888999998864 45888776


No 24 
>KOG2424|consensus
Probab=34.42  E-value=57  Score=23.75  Aligned_cols=29  Identities=24%  Similarity=0.361  Sum_probs=19.8

Q ss_pred             CCCchHHHHHHHHHHHhcC--CCChHHHHHH
Q psy13939         32 PENGTWFIQCLCQELADSG--TKLDLLSIMT   60 (86)
Q Consensus        32 ~~~GSwFIq~Lc~vl~~~~--~~~dl~~ilt   60 (86)
                      ..-|..+|-+||+.|....  .+.+|.+||+
T Consensus       148 A~~Gaf~I~elcq~l~~~s~d~Ed~ideil~  178 (195)
T KOG2424|consen  148 ATLGAFLILELCQCLQAQSDDLEDNIDEILL  178 (195)
T ss_pred             hhhhHHHHHHHHHHHHhccccHHHHHHHHHH
Confidence            3579999999999999622  2334555554


No 25 
>PF04819 DUF716:  Family of unknown function (DUF716) ;  InterPro: IPR006904 These sequences are a family of uncharacterised hypothetical proteins restricted to eukaryotes. Q9SLW7 from SWISSPROT represents a sequence from Nicotiana tabacum (Common tobacco)which is up regulated in response to TMV infection.
Probab=33.97  E-value=18  Score=24.34  Aligned_cols=15  Identities=33%  Similarity=0.457  Sum_probs=11.7

Q ss_pred             CchHHHHHHHHHHHh
Q psy13939         34 NGTWFIQCLCQELAD   48 (86)
Q Consensus        34 ~GSwFIq~Lc~vl~~   48 (86)
                      .|+||+|.-.-....
T Consensus        73 qGtWf~Q~g~~Ly~p   87 (137)
T PF04819_consen   73 QGTWFWQIGFILYPP   87 (137)
T ss_pred             HHHHHHHHHHHhcCC
Confidence            699999987666555


No 26 
>PF12993 DUF3877:  Domain of unknown function, E. rectale Gene description (DUF3877);  InterPro: IPR024539  This entry represents proteins of unknown function found primarily in Firmicutes. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture []. 
Probab=32.59  E-value=64  Score=23.15  Aligned_cols=28  Identities=25%  Similarity=0.430  Sum_probs=20.0

Q ss_pred             CCchHHHHHHHHHHHhcCCCC-hHHHHHH
Q psy13939         33 ENGTWFIQCLCQELADSGTKL-DLLSIMT   60 (86)
Q Consensus        33 ~~GSwFIq~Lc~vl~~~~~~~-dl~~ilt   60 (86)
                      ...+-||++|.+.+.+|+.+. +|.+++.
T Consensus        91 ~~~~eFik~lIe~v~~hgcT~e~I~~~F~  119 (175)
T PF12993_consen   91 TKENEFIKELIELVGKHGCTLEDILELFH  119 (175)
T ss_pred             CCCCHHHHHHHHHHhcCCcCHHHHHHHHH
Confidence            466889999999999976432 4555443


No 27 
>PF00806 PUF:  Pumilio-family RNA binding repeat;  InterPro: IPR001313 The drosophila pumilio gene codes for an unusual protein that binds through the Puf domain that usually occurs as a tandem repeat of eight domains. The FBF-2 protein of Caenorhabditis elegans also has a Puf domain. Both proteins function as translational repressors in early embryonic development by binding sequences in the 3' UTR of target mRNAs [, ]. The same type of repetitive domain has been found in in a number of other proteins from all eukaryotic kingdoms. The Puf proteins characterised to date have been reported to bind to 3'-untranslated region (UTR) sequences encompassing a so-called UGUR tetranucleotide motif and thereby to repress gene expression by affecting mRNA translation or stability.  In Saccharomyces cerevisiae (Baker's yeast), five proteins, termed Puf1p to Puf5p, bear six to eight Puf repeats []. Puf3p binds nearly exclusively to cytoplasmic mRNAs that encode mitochondrial proteins; Puf1p and Puf2p interact preferentially with mRNAs encoding membrane-associated proteins; Puf4p preferentially binds mRNAs encoding nucleolar ribosomal RNA-processing factors; and Puf5p is associated with mRNAs encoding chromatin modifiers and components of the spindle pole body. This suggests the existence of an extensive network of RNA-protein interactions that coordinate the post-transcriptional fate of large sets of cytotopically and functionally related RNAs through each stage of its lifecycle.; GO: 0003723 RNA binding; PDB: 3BX2_A 4DZS_B 3BX3_B 3BWT_A 3GVT_B 3GVO_A 1IB2_A 3Q0N_A 2YJY_A 1M8Z_A ....
Probab=30.71  E-value=46  Score=16.55  Aligned_cols=13  Identities=15%  Similarity=0.353  Sum_probs=11.7

Q ss_pred             CCchHHHHHHHHH
Q psy13939         33 ENGTWFIQCLCQE   45 (86)
Q Consensus        33 ~~GSwFIq~Lc~v   45 (86)
                      ..||+.||.+.+.
T Consensus        13 ~~Gn~VvQk~le~   25 (35)
T PF00806_consen   13 QYGNYVVQKCLEH   25 (35)
T ss_dssp             TTHHHHHHHHHHH
T ss_pred             cccCHHHHHHHHH
Confidence            6899999999887


No 28 
>COG1955 FlaJ Archaeal flagella assembly protein J [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=28.05  E-value=68  Score=26.68  Aligned_cols=39  Identities=23%  Similarity=0.424  Sum_probs=26.2

Q ss_pred             CCCccccC--CCCCchHHHHHHHHHHHhc----CCCChHHHHHHH
Q psy13939         23 FVSFYSWR--HPENGTWFIQCLCQELADS----GTKLDLLSIMTR   61 (86)
Q Consensus        23 ~~g~~s~R--~~~~GSwFIq~Lc~vl~~~----~~~~dl~~ilt~   61 (86)
                      ..--.|||  .-++|||.||-+.++|.+-    |.-..+-++.-+
T Consensus       351 ids~~aW~~F~aeTGS~LI~~~S~if~d~i~lGGdp~~~GeiIS~  395 (527)
T COG1955         351 IDSNKAWRLFSAETGSYLISKFSEIFTDAIDLGGDPDVVGEIISE  395 (527)
T ss_pred             CCHHHHHHHhhcCchhHHHHHHHHHHHHHHHcCCCHHHHHHHHHH
Confidence            34456777  4589999999999999873    344444444433


No 29 
>smart00025 Pumilio Pumilio-like repeats. Pumilio-like repeats that bind RNA.
Probab=26.99  E-value=50  Score=15.64  Aligned_cols=15  Identities=20%  Similarity=0.299  Sum_probs=12.0

Q ss_pred             CCchHHHHHHHHHHH
Q psy13939         33 ENGTWFIQCLCQELA   47 (86)
Q Consensus        33 ~~GSwFIq~Lc~vl~   47 (86)
                      ..||+.||.+.+...
T Consensus        13 ~~g~~viqk~l~~~~   27 (36)
T smart00025       13 QYGNRVVQKLLEHAS   27 (36)
T ss_pred             chhhHHHHHHHHHCC
Confidence            689999999877544


No 30 
>PF15463 ECM11:  Extracellular mutant protein 11
Probab=25.90  E-value=76  Score=21.21  Aligned_cols=35  Identities=14%  Similarity=0.372  Sum_probs=21.6

Q ss_pred             CCchHHHHHHHHHHHhcC-CCChHHHHHHHHHHHHH
Q psy13939         33 ENGTWFIQCLCQELADSG-TKLDLLSIMTRVSRRVA   67 (86)
Q Consensus        33 ~~GSwFIq~Lc~vl~~~~-~~~dl~~ilt~Vn~~Va   67 (86)
                      ..|-|||+.+++++.+-- ....+-.++...+..|.
T Consensus        76 ~~Gd~~l~qf~~l~~kl~~~R~~~r~~~~~fe~eI~  111 (139)
T PF15463_consen   76 EAGDWFLEQFSELMQKLKEARRKLRKKFAVFEDEIN  111 (139)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            379999999999998753 22333344443344443


No 31 
>PF04895 DUF651:  Archaeal protein of unknown function (DUF651);  InterPro: IPR006979 This conserved region is found in the C-terminal region of a number of conserved archaeal proteins of unknown function.
Probab=25.29  E-value=1.3e+02  Score=19.87  Aligned_cols=42  Identities=17%  Similarity=0.273  Sum_probs=32.3

Q ss_pred             cCCCccccCCCCCchHHHHHHHHHHHhcC--CCChHHHHHHHHHHHHH
Q psy13939         22 VFVSFYSWRHPENGTWFIQCLCQELADSG--TKLDLLSIMTRVSRRVA   67 (86)
Q Consensus        22 T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~--~~~dl~~ilt~Vn~~Va   67 (86)
                      -.|||.+    --|-|+|.+-+...-+..  .-.+|.+-+..|+.++.
T Consensus        42 I~p~Y~~----PlGvW~VRE~vR~A~~~~p~~f~~l~eAl~~~~~~l~   85 (110)
T PF04895_consen   42 ITPEYYA----PLGVWQVRENVRKAMKGKPEKFETLEEALEYVSSRLK   85 (110)
T ss_pred             ecCCcee----eeeeehHHHHHHHHHhCCCcccCCHHHHHHHHHHHhC
Confidence            6778766    479999998887665443  45689999999988884


No 32 
>PF12887 SICA_alpha:  SICA extracellular alpha domain;  InterPro: IPR024290 The schizont-infected cell agglutination (SICA) proteins of Plasmodium knowlesi, one of the variant antigen gene families, are associated with parasitic virulence. SICA proteins comprise multiple domains, with the extracellular cysteine-rich domains (CRDs) occurring at different frequencies. They contain a five-cysteine CRD (SICA-alpha) at the N terminus, which occurs once or twice, then between 1 and 10 SICA-beta CRDs with 7-10 cysteine residues, a transmembrane domain, and a conserved C-terminal domain []. This entry represents the extracellular SICA-alpha domain.
Probab=24.96  E-value=1.9e+02  Score=20.22  Aligned_cols=41  Identities=15%  Similarity=0.373  Sum_probs=27.3

Q ss_pred             CCchHHHHHHHHHHHh---cCCCChHHHHHHHHHHHHHhhhhcc
Q psy13939         33 ENGTWFIQCLCQELAD---SGTKLDLLSIMTRVSRRVALDMESY   73 (86)
Q Consensus        33 ~~GSwFIq~Lc~vl~~---~~~~~dl~~ilt~Vn~~Va~~~~s~   73 (86)
                      ..--||+++++-.+.-   ++..+++-+++..|...|...-...
T Consensus       109 ~~~~~Y~RCIVG~vaL~~iygdhC~~~~vi~~i~~~v~~~l~~~  152 (184)
T PF12887_consen  109 DDWEAYLRCIVGAVALSEIYGDHCKLKKVIQKISDKVEEKLKGH  152 (184)
T ss_pred             chHHhcchhHHhHHHHHHHHhccCCHHHHHHHHHHHHHHhcccC
Confidence            3456888877644332   4677888888888888886444333


No 33 
>PF12221 HflK_N:  Bacterial membrane protein N terminal;  InterPro: IPR020980  HflK is a bacterial membrane protein which is thought, together with the HflC protein, to form a membrane protease complex whose activity is modulated by the GTPase HflX []. This entry represents the N-terminal, membrane-spanning, region of of HflK responsible for anchoring the protein in the bacterial membrane. It is often found in association with PF01145 from PFAM.
Probab=21.83  E-value=98  Score=17.01  Aligned_cols=18  Identities=11%  Similarity=0.189  Sum_probs=15.2

Q ss_pred             CCChHHHHHHHHHHHHHh
Q psy13939         51 TKLDLLSIMTRVSRRVAL   68 (86)
Q Consensus        51 ~~~dl~~ilt~Vn~~Va~   68 (86)
                      .--||.+|+...++++..
T Consensus        19 gPPDLdel~r~l~~kl~~   36 (42)
T PF12221_consen   19 GPPDLDELFRKLQDKLGG   36 (42)
T ss_pred             CCCCHHHHHHHHHHHHhc
Confidence            366999999999999864


No 34 
>PRK05883 acyl carrier protein; Validated
Probab=21.13  E-value=1.3e+02  Score=18.62  Aligned_cols=24  Identities=13%  Similarity=0.142  Sum_probs=17.3

Q ss_pred             CCccccCCCCCc----hHHHHHHHHHHH
Q psy13939         24 VSFYSWRHPENG----TWFIQCLCQELA   47 (86)
Q Consensus        24 ~g~~s~R~~~~G----SwFIq~Lc~vl~   47 (86)
                      ||-.|||++..-    .|++.-|++.|.
T Consensus         1 ~~~~~~~~~~~~~~I~~~l~~iia~~l~   28 (91)
T PRK05883          1 PGVASFAMTSSPSTVSATLLSILRDDLN   28 (91)
T ss_pred             CCcCccCCCCCHHHHHHHHHHHHHHHhC
Confidence            788899987654    466777777764


No 35 
>cd08332 CARD_CASP2 Caspase activation and recruitment domain of Caspase-2. Caspase activation and recruitment domain (CARD) similar to that found in caspase-2. Caspases are aspartate-specific cysteine proteases with functions in apoptosis and immune signaling. Caspase-2 (also known as ICH1, NEDD2, or CASP2) is one of the most evolutionarily conserved caspases, and plays a role in apoptosis, DNA damage response, cell cycle regulation, and tumor suppression. It is localized in the nucleus and exhibits properties of both an initiator and an effector caspase. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including PYRIN and
Probab=21.09  E-value=87  Score=19.47  Aligned_cols=27  Identities=15%  Similarity=0.474  Sum_probs=18.2

Q ss_pred             CchHHHHHHHHHHHhcCCCChHHHHHHH
Q psy13939         34 NGTWFIQCLCQELADSGTKLDLLSIMTR   61 (86)
Q Consensus        34 ~GSwFIq~Lc~vl~~~~~~~dl~~ilt~   61 (86)
                      .|.-=-..||++|++.+ ..||.++|.+
T Consensus        63 RG~~AF~~F~~aL~~~~-~~~La~lL~~   89 (90)
T cd08332          63 RGPRAFSAFCEALRETS-QEHLCDLLEK   89 (90)
T ss_pred             hChhHHHHHHHHHHhcC-hHHHHHHHhh
Confidence            34444567899997643 4688888854


No 36 
>cd08802 Death_UNC5B Death domain found in Uncoordinated-5B. Death Domain (DD) found in Uncoordinated-5B (UNC5B). UNC5B is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5B signaling is involved in the netrin-1-induced proliferation and migration of renal proximal tubular cells. It is also required for vascular patterning during embryonic development, and its activation inhibits sprouting angiogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activatio
Probab=20.87  E-value=1e+02  Score=19.41  Aligned_cols=19  Identities=21%  Similarity=0.342  Sum_probs=13.4

Q ss_pred             HHHHHHHHHhcCCCChHHH
Q psy13939         39 IQCLCQELADSGTKLDLLS   57 (86)
Q Consensus        39 Iq~Lc~vl~~~~~~~dl~~   57 (86)
                      |+.|+++|++.++..-+.-
T Consensus        63 v~~L~~~L~~mgR~D~~~~   81 (84)
T cd08802          63 LNSLASALEEMGKSEMLVV   81 (84)
T ss_pred             HHHHHHHHHHcCcchHHHH
Confidence            6888888888766555543


No 37 
>PF12022 DUF3510:  Domain of unknown function (DUF3510);  InterPro: IPR024603  The COG complex comprises eight proteins (COG1-8) and plays critical roles in Golgi structure and function []. This uncharacterised domain is found in the C-terminal of COG complex subunit 2 proteins.
Probab=20.45  E-value=1.8e+02  Score=19.09  Aligned_cols=42  Identities=10%  Similarity=0.059  Sum_probs=29.4

Q ss_pred             CCCCchHHHHHHHHHHHhc-------CCCChHHHHHHHHHHHHHhhhhc
Q psy13939         31 HPENGTWFIQCLCQELADS-------GTKLDLLSIMTRVSRRVALDMES   72 (86)
Q Consensus        31 ~~~~GSwFIq~Lc~vl~~~-------~~~~dl~~ilt~Vn~~Va~~~~s   72 (86)
                      -|.+-||||..+..-|...       .....+.+++..|-..|...|-.
T Consensus        29 ~Pt~~S~yV~~il~Pl~~F~~~~~~~~~~~~~~~~~~~v~~~v~~~y~~   77 (125)
T PF12022_consen   29 VPTKPSPYVSSILRPLKSFLEEYSSYLSPEIIEEWLQKVITEVTERYYE   77 (125)
T ss_pred             CCCCccHHHHHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHHHHHH
Confidence            4567899998887777653       23457777888777777766644


No 38 
>KOG4417|consensus
Probab=20.23  E-value=57  Score=24.51  Aligned_cols=24  Identities=13%  Similarity=0.308  Sum_probs=20.3

Q ss_pred             cCCCccccCCCCCchHHHHHHHHHHHh
Q psy13939         22 VFVSFYSWRHPENGTWFIQCLCQELAD   48 (86)
Q Consensus        22 T~~g~~s~R~~~~GSwFIq~Lc~vl~~   48 (86)
                      -+|||.|||..   -|+.+-|-.+..+
T Consensus        87 YvPgfLafREa---~v~l~~L~~v~~e  110 (261)
T KOG4417|consen   87 YVPGFLAFREA---EVMLDFLKSVITE  110 (261)
T ss_pred             cCccceeeehh---HHHHHHHHhcccc
Confidence            79999999985   6999988888754


No 39 
>PHA02593 62 clamp loader small subunit; Provisional
Probab=20.21  E-value=98  Score=22.50  Aligned_cols=37  Identities=16%  Similarity=0.329  Sum_probs=27.9

Q ss_pred             CCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHH
Q psy13939         24 VSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVS   63 (86)
Q Consensus        24 ~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn   63 (86)
                      +.-.|||+..  ===||+||+.|.+. .+..|..||..||
T Consensus        14 EHeiAW~skD--w~~V~elad~fke~-~en~lF~ii~~it   50 (191)
T PHA02593         14 EHEIAWRSKD--WDAVQELADSFKEK-AENELFAIIDDIT   50 (191)
T ss_pred             HHHHHHhccC--HHHHHHHHHHhCcc-hhhHHHHHHHHHh
Confidence            3446888853  23699999999987 4568888988877


Done!