Query         psy13955
Match_columns 74
No_of_seqs    130 out of 1012
Neff          8.4 
Searched_HMMs 46136
Date          Fri Aug 16 15:52:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13955.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13955hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4389|consensus               99.8 4.2E-21 9.1E-26  131.5   5.5   68    2-74    433-508 (601)
  2 cd00312 Esterase_lipase Estera  99.7 5.5E-17 1.2E-21  110.7   6.5   66    3-74    384-460 (493)
  3 PF00135 COesterase:  Carboxyle  99.6 7.4E-16 1.6E-20  105.0   4.3   60   10-74    427-495 (535)
  4 COG2272 PnbA Carboxylesterase   99.5 1.1E-14 2.3E-19  100.1   6.2   70    2-74    369-444 (491)
  5 KOG1516|consensus               98.2   5E-06 1.1E-10   57.9   5.7   63    4-74    424-499 (545)
  6 COG2238 RPS19A Ribosomal prote  52.1     6.3 0.00014   23.8   0.5    8   67-74     31-38  (147)
  7 PF06296 DUF1044:  Protein of u  37.4      50  0.0011   19.3   2.7   38   29-71     67-104 (120)
  8 PHA02277 hypothetical protein   30.0      45 0.00098   19.9   1.7   22   53-74      6-27  (150)
  9 PF10642 Tom5:  Mitochondrial i  30.0      78  0.0017   15.6   2.4   13   50-62      7-19  (49)
 10 PRK09333 30S ribosomal protein  29.2      20 0.00043   21.8   0.2    9   66-74     30-38  (150)
 11 cd02639 R3H_RRM R3H domain of   28.7      90   0.002   15.9   2.7   19   49-67     23-41  (60)
 12 PF08756 YfkB:  YfkB-like domai  28.5      76  0.0016   19.3   2.5   31   30-65     30-60  (153)
 13 PF02315 MDH:  Methanol dehydro  28.4      93   0.002   17.4   2.7   17   58-74     68-84  (93)
 14 PF13137 DUF3983:  Protein of u  25.5      72  0.0016   14.5   1.6   14   61-74     19-33  (34)
 15 PF13869 NUDIX_2:  Nucleotide h  25.1      13 0.00028   23.4  -1.2   21   54-74     21-41  (188)
 16 KOG1689|consensus               24.7      51  0.0011   20.8   1.4   22   53-74     46-67  (221)
 17 PF14293 YWFCY:  YWFCY protein   22.5      83  0.0018   16.3   1.7   11   64-74     47-57  (61)
 18 PF09936 Methyltrn_RNA_4:  SAM-  22.4   1E+02  0.0022   19.4   2.4   17   53-69     51-67  (185)
 19 PF07888 CALCOCO1:  Calcium bin  20.9      43 0.00094   24.5   0.6   25   16-40     89-113 (546)
 20 PF11294 DUF3095:  Protein of u  20.6 1.2E+02  0.0026   21.2   2.7   13   27-39     63-75  (373)
 21 PF08588 DUF1769:  Protein of u  20.2 1.4E+02  0.0031   15.1   2.4    8   36-43      5-12  (56)
 22 PF03369 Herpes_UL3:  Herpesvir  20.1      67  0.0015   19.0   1.2   11   12-22    112-122 (134)

No 1  
>KOG4389|consensus
Probab=99.83  E-value=4.2e-21  Score=131.51  Aligned_cols=68  Identities=26%  Similarity=0.406  Sum_probs=61.3

Q ss_pred             HHHHHhHh-cCCCeeEEEecCC-------CCCCCCCcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHhccc
Q psy13955          2 IVDENSHH-LTCGGIIYLFCPL-------ETDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARS   73 (74)
Q Consensus         2 ~~~a~~~a-~~~~~y~Y~f~~~-------~~~Ga~H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nFakt   73 (74)
                      +++|++++ +++.||+|.|+|+       .|+|++||.||-|+||.|+..     ..+++++|+.+|++||++|+|||||
T Consensus       433 ~e~A~~~~~~g~~v~~YyFthrsSa~pWP~WmGVmHGYEIEyvFG~PL~~-----s~nYt~~E~~ls~rim~~WanFAkt  507 (601)
T KOG4389|consen  433 NEFADALAEQGASVYYYYFTHRSSANPWPKWMGVMHGYEIEYVFGIPLNY-----SRNYTKEEKILSRRIMRYWANFAKT  507 (601)
T ss_pred             HHHHHHHHHhcCcEEEEEEeccccCCCchhhhcCcccceEEEEecccccc-----cccccHHHHHHHHHHHHHHHHHhhc
Confidence            56888888 5789999999994       689999999999999999862     4678999999999999999999999


Q ss_pred             C
Q psy13955         74 G   74 (74)
Q Consensus        74 G   74 (74)
                      |
T Consensus       508 G  508 (601)
T KOG4389|consen  508 G  508 (601)
T ss_pred             C
Confidence            8


No 2  
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.
Probab=99.69  E-value=5.5e-17  Score=110.73  Aligned_cols=66  Identities=23%  Similarity=0.301  Sum_probs=53.0

Q ss_pred             HHHHhHhc--CCCeeEEEecCC---------CCCCCCCcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHhc
Q psy13955          3 VDENSHHL--TCGGIIYLFCPL---------ETDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFA   71 (74)
Q Consensus         3 ~~a~~~a~--~~~~y~Y~f~~~---------~~~Ga~H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nFa   71 (74)
                      ..|+.+++  +.+||+|+|+|+         ...|++|++||+|+||.+...      ...+++|++++++|+++|+|||
T Consensus       384 ~~a~~~~~~~~~~vY~Y~F~~~~~~~~~~~~~~~Ga~H~~Dl~ylFg~~~~~------~~~~~~d~~ls~~m~~~w~nFa  457 (493)
T cd00312         384 YFLAQHRKAGGSPVYAYVFDHRSSLSVGRWPPWLGTVHGDEIFFVFGNPLLK------EGLREEEEKLSRTMMKYWANFA  457 (493)
T ss_pred             HHHHHHHhccCCCeEEEEeccCCcCCccccCCCCCcccCCceeeecCCCCCC------CCCCcHHHHHHHHHHHHHHHHh
Confidence            45666653  689999999984         346999999999999987542      1234778999999999999999


Q ss_pred             ccC
Q psy13955         72 RSG   74 (74)
Q Consensus        72 ktG   74 (74)
                      |+|
T Consensus       458 ktG  460 (493)
T cd00312         458 KTG  460 (493)
T ss_pred             hhC
Confidence            997


No 3  
>PF00135 COesterase:  Carboxylesterase family The prints entry is specific to acetylcholinesterase;  InterPro: IPR002018 Higher eukaryotes have many distinct esterases. Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
Probab=99.60  E-value=7.4e-16  Score=104.96  Aligned_cols=60  Identities=22%  Similarity=0.374  Sum_probs=50.1

Q ss_pred             cCCCeeEEEecCCC---------CCCCCCcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHhcccC
Q psy13955         10 LTCGGIIYLFCPLE---------TDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG   74 (74)
Q Consensus        10 ~~~~~y~Y~f~~~~---------~~Ga~H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nFaktG   74 (74)
                      .+.++|+|+|+|+.         +.|++|++|++|+||.+...     ....+++|+.+++.|+++|+||||+|
T Consensus       427 ~~~~vY~Y~F~~~~~~~~~~~~~~~ga~H~~Dl~ylFg~~~~~-----~~~~~~~~~~ls~~m~~~w~nFak~G  495 (535)
T PF00135_consen  427 GGSPVYLYRFDYPPPFIFSPDPPWRGACHGDDLPYLFGNPFLS-----PPNPTEDDRKLSDQMQRYWTNFAKTG  495 (535)
T ss_dssp             TTSCEEEEEEHHSSTTSTECSETTGTSBTTTTHHHHTTGCCHC-----HHHTCHHHHHHHHHHHHHHHHHHHHS
T ss_pred             cccccceeecccccccccccccccccccchhhhhhhcCCCccc-----ccccccHHHHHHHHHHHHHHhcCCCC
Confidence            46899999999942         56999999999999987642     11127899999999999999999997


No 4  
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism]
Probab=99.55  E-value=1.1e-14  Score=100.12  Aligned_cols=70  Identities=16%  Similarity=0.091  Sum_probs=57.3

Q ss_pred             HHHHHhHhcCCCeeEEEecCC------CCCCCCCcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHhcccC
Q psy13955          2 IVDENSHHLTCGGIIYLFCPL------ETDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG   74 (74)
Q Consensus         2 ~~~a~~~a~~~~~y~Y~f~~~------~~~Ga~H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nFaktG   74 (74)
                      ++.|+.|+.+.|+|+|+|+++      ...||+|+.||+++||++...+   .....+++++++|++|...|+||||+|
T Consensus       369 ~~~a~a~~~~ap~w~Yrf~~~~~~~~~~~~gA~H~~El~~Vfg~~~~~~---~~~~~~~~~~~~s~~~~~~w~nFArtg  444 (491)
T COG2272         369 IRLAQAQSAGAPTWLYRFDYAPDTVRVPGFGAPHATELSLVFGNLVALG---SAAQTARATAKLSRQMQDAWANFARTG  444 (491)
T ss_pred             HHHHHhcccCCCeeEEEeccCCcccccccCCCccccceeeeeccccccc---cccccchHHHHHHHHHHHHHHHHHhcC
Confidence            567777777899999999995      3579999999999999875221   123457778899999999999999997


No 5  
>KOG1516|consensus
Probab=98.17  E-value=5e-06  Score=57.88  Aligned_cols=63  Identities=16%  Similarity=0.125  Sum_probs=45.0

Q ss_pred             HHHhHhc-CCCeeEEEecCC------------CCCCCCCcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHh
Q psy13955          4 DENSHHL-TCGGIIYLFCPL------------ETDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNF   70 (74)
Q Consensus         4 ~a~~~a~-~~~~y~Y~f~~~------------~~~Ga~H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nF   70 (74)
                      .++.+.. +.++|+|.|++.            ...|+.|++|+.|+|+.+....    ....++.|..+    +.+|+||
T Consensus       424 ~~~~~~~~~~~~~~y~f~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~----~~~~~~~~~~~----~~~~~~f  495 (545)
T KOG1516|consen  424 LLRLRREYGNPVYLYSFDYDNPVNFGRPGEKDPDTGVEHADDLRYLFGENFLKR----PVMKSSFEKKL----IELWTNF  495 (545)
T ss_pred             HHHHHHhcCCCeEEEEEEecCcccccccccccCccCCcccccceeecccccccc----CCCCChHHHHH----HHHHHHH
Confidence            3344443 369999999993            1248999999999999865321    22335566655    9999999


Q ss_pred             cccC
Q psy13955         71 ARSG   74 (74)
Q Consensus        71 aktG   74 (74)
                      |++|
T Consensus       496 a~~g  499 (545)
T KOG1516|consen  496 AKTG  499 (545)
T ss_pred             HhhC
Confidence            9987


No 6  
>COG2238 RPS19A Ribosomal protein S19E (S16A) [Translation, ribosomal structure and biogenesis]
Probab=52.10  E-value=6.3  Score=23.81  Aligned_cols=8  Identities=13%  Similarity=0.526  Sum_probs=7.5

Q ss_pred             HHHhcccC
Q psy13955         67 VSNFARSG   74 (74)
Q Consensus        67 w~nFaktG   74 (74)
                      |++|+|||
T Consensus        31 wa~~vKTG   38 (147)
T COG2238          31 WADIVKTG   38 (147)
T ss_pred             hhhhhhcc
Confidence            99999998


No 7  
>PF06296 DUF1044:  Protein of unknown function (DUF1044);  InterPro: IPR009387 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=37.42  E-value=50  Score=19.27  Aligned_cols=38  Identities=8%  Similarity=0.103  Sum_probs=27.0

Q ss_pred             CcCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHHHHHHhc
Q psy13955         29 SGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFA   71 (74)
Q Consensus        29 H~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~~w~nFa   71 (74)
                      +++.+-|+++.+-..     ..+.|++|++.-+.+...+.++.
T Consensus        67 ~~~~~~~l~~y~K~~-----~~nis~~El~~lk~la~~l~~~~  104 (120)
T PF06296_consen   67 QEDRIFFLYIYAKNE-----KANISDKELKALKKLAKELLNLS  104 (120)
T ss_pred             eCCEEEEEEEEcccc-----cCCCCHHHHHHHHHHHHHHHHhC
Confidence            466667776654321     45679999988888888888764


No 8  
>PHA02277 hypothetical protein
Probab=30.05  E-value=45  Score=19.88  Aligned_cols=22  Identities=18%  Similarity=-0.003  Sum_probs=17.7

Q ss_pred             CHHHHHHHHHHHHHHHHhcccC
Q psy13955         53 TTREKLHSEVILTWVSNFARSG   74 (74)
Q Consensus        53 ~~~d~~~s~~~~~~w~nFaktG   74 (74)
                      +..-+.+|..=++.|.+|.-||
T Consensus         6 sth~K~iS~~Dm~~W~e~V~tg   27 (150)
T PHA02277          6 STHTKGISQADMEKWIEAVVQG   27 (150)
T ss_pred             hHHHhhccHHHHHHHHHHHHhC
Confidence            4556678888899999999876


No 9  
>PF10642 Tom5:  Mitochondrial import receptor subunit or translocase;  InterPro: IPR019603  This entry represents a short family of yeast proteins. Tom5 is one of three very small translocases of the mitochondrial outer membrane. Tom5 links mitochondrial preprotein receptors to the general import pore []. Although Tom5 has allegedly been identified in vertebrates this could not be confirmed. 
Probab=30.01  E-value=78  Score=15.56  Aligned_cols=13  Identities=15%  Similarity=0.105  Sum_probs=8.0

Q ss_pred             CCCCHHHHHHHHH
Q psy13955         50 SKYTTREKLHSEV   62 (74)
Q Consensus        50 ~~~~~~d~~~s~~   62 (74)
                      ...|+||+++.+.
T Consensus         7 ~qpS~eE~k~~e~   19 (49)
T PF10642_consen    7 PQPSEEEIKAAEA   19 (49)
T ss_pred             CCCCHHHHHHHHH
Confidence            3458888766543


No 10 
>PRK09333 30S ribosomal protein S19e; Provisional
Probab=29.15  E-value=20  Score=21.81  Aligned_cols=9  Identities=22%  Similarity=0.438  Sum_probs=7.5

Q ss_pred             HHHHhcccC
Q psy13955         66 WVSNFARSG   74 (74)
Q Consensus        66 ~w~nFaktG   74 (74)
                      =|++|+|||
T Consensus        30 ~W~~~vKTg   38 (150)
T PRK09333         30 EWAAFVKTG   38 (150)
T ss_pred             cchhhhccc
Confidence            389999987


No 11 
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=28.71  E-value=90  Score=15.85  Aligned_cols=19  Identities=11%  Similarity=0.162  Sum_probs=14.6

Q ss_pred             CCCCCHHHHHHHHHHHHHH
Q psy13955         49 KSKYTTREKLHSEVILTWV   67 (74)
Q Consensus        49 ~~~~~~~d~~~s~~~~~~w   67 (74)
                      +...|++|+++...+...+
T Consensus        23 p~~ls~~eRriih~la~~l   41 (60)
T cd02639          23 PSSLSPAERRIVHLLASRL   41 (60)
T ss_pred             CCCCCHHHHHHHHHHHHHc
Confidence            4567999999888877654


No 12 
>PF08756 YfkB:  YfkB-like domain;  InterPro: IPR014866 YfkB is adjacent to YfkA in Bacillus subtilis. In other bacterial species, it is fused to this protein. As YfkA contains a Radical SAM domain it suggests this domain is interacts with them. 
Probab=28.54  E-value=76  Score=19.32  Aligned_cols=31  Identities=10%  Similarity=0.022  Sum_probs=20.7

Q ss_pred             cCchhhhcCCcCCCCCCccCCCCCHHHHHHHHHHHH
Q psy13955         30 GEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILT   65 (74)
Q Consensus        30 ~~dl~y~F~~~~~~~~~~~~~~~~~~d~~~s~~~~~   65 (74)
                      -.|+.-|||+...     ++-...++|+++.+++.+
T Consensus        30 d~~~WMLFGTLPf-----y~Cs~~eeD~~Ll~RL~~   60 (153)
T PF08756_consen   30 DPNVWMLFGTLPF-----YPCSDDEEDLALLKRLRS   60 (153)
T ss_pred             CCCeeEEeccccc-----ccCCCCHHHHHHHHHHHh
Confidence            4677889997321     244457889988877653


No 13 
>PF02315 MDH:  Methanol dehydrogenase beta subunit;  InterPro: IPR003420 Methanol dehydrogenase (MDH) (1.1.99.8 from EC), found in Gram-negative bacteria, is a pyrroloquinoline quinone (PQQ)-containing enzyme which oxidises methanol to formaldehyde. It is located in the periplasmic space and passes electrons derived from the oxidation of methanol to the soluble cytochrome cL []. The enzyme is a tetramer composed of two large alpha subunits and two smaller beta subunits. The alpha subunit binds the PQQ cofactor and contains the active site, while the function of the beta subunit is currently unknown []. The alpha subunit forms an eight-bladed propeller structure, with several novel tryptophan-docking motifs linking the individual blades together. This entry represents the beta subunit of methanol dehydrogenase.; GO: 0004022 alcohol dehydrogenase (NAD) activity, 0015946 methanol oxidation, 0055114 oxidation-reduction process; PDB: 1LRW_B 2D0V_J 2AD6_B 1G72_B 4AAH_D 2AD8_D 2AD7_D 1H4J_D 1H4I_B 1W6S_B ....
Probab=28.39  E-value=93  Score=17.35  Aligned_cols=17  Identities=29%  Similarity=0.366  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHhcccC
Q psy13955         58 LHSEVILTWVSNFARSG   74 (74)
Q Consensus        58 ~~s~~~~~~w~nFaktG   74 (74)
                      .|-+|=...+.||.+||
T Consensus        68 ~me~RN~kR~~~fkkTG   84 (93)
T PF02315_consen   68 AMEERNAKRVENFKKTG   84 (93)
T ss_dssp             HHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHhcC
Confidence            46667778899999998


No 14 
>PF13137 DUF3983:  Protein of unknown function (DUF3983)
Probab=25.52  E-value=72  Score=14.48  Aligned_cols=14  Identities=21%  Similarity=0.197  Sum_probs=8.5

Q ss_pred             HHHHHHHHH-hcccC
Q psy13955         61 EVILTWVSN-FARSG   74 (74)
Q Consensus        61 ~~~~~~w~n-FaktG   74 (74)
                      .++-..|-| |++.|
T Consensus        19 ~rv~kAWRNiFvqag   33 (34)
T PF13137_consen   19 YRVDKAWRNIFVQAG   33 (34)
T ss_pred             HHHHHHHHHHHHHcc
Confidence            566777777 44443


No 15 
>PF13869 NUDIX_2:  Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A ....
Probab=25.13  E-value=13  Score=23.44  Aligned_cols=21  Identities=10%  Similarity=0.270  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHhcccC
Q psy13955         54 TREKLHSEVILTWVSNFARSG   74 (74)
Q Consensus        54 ~~d~~~s~~~~~~w~nFaktG   74 (74)
                      ++|..+.+++.++-.||.+.|
T Consensus        21 ekd~s~~~rl~rl~~~y~~~G   41 (188)
T PF13869_consen   21 EKDPSVAARLQRLKENYEKEG   41 (188)
T ss_dssp             -SSSSHHHHHHHHHHHHHHHS
T ss_pred             ccccCHHHHHHHHHHHHHHhC
Confidence            345668888999999999877


No 16 
>KOG1689|consensus
Probab=24.73  E-value=51  Score=20.79  Aligned_cols=22  Identities=5%  Similarity=0.213  Sum_probs=16.8

Q ss_pred             CHHHHHHHHHHHHHHHHhcccC
Q psy13955         53 TTREKLHSEVILTWVSNFARSG   74 (74)
Q Consensus        53 ~~~d~~~s~~~~~~w~nFaktG   74 (74)
                      -+.|..+++++.++=.+|.|-|
T Consensus        46 ~eKD~svadrf~rmk~ey~k~g   67 (221)
T KOG1689|consen   46 REKDESVADRFARMKIEYMKEG   67 (221)
T ss_pred             hhccchHHHHHHHHHHHHHhhh
Confidence            3456778899999888887755


No 17 
>PF14293 YWFCY:  YWFCY protein
Probab=22.50  E-value=83  Score=16.25  Aligned_cols=11  Identities=36%  Similarity=0.519  Sum_probs=6.4

Q ss_pred             HHHHHHhcccC
Q psy13955         64 LTWVSNFARSG   74 (74)
Q Consensus        64 ~~~w~nFaktG   74 (74)
                      -++..||.|||
T Consensus        47 DrIL~n~~rt~   57 (61)
T PF14293_consen   47 DRILLNFQRTG   57 (61)
T ss_pred             HHHHHHHHhhc
Confidence            34556666664


No 18 
>PF09936 Methyltrn_RNA_4:  SAM-dependent RNA methyltransferase;  InterPro: IPR019230  This entry contains proteins that have no known function. They are found as separate proteins and as a C-terminal domain to tRNA (guanine-N(1)-)-methyltransferases to which they are structurally related. ; PDB: 3DCM_X.
Probab=22.39  E-value=1e+02  Score=19.44  Aligned_cols=17  Identities=18%  Similarity=0.100  Sum_probs=13.9

Q ss_pred             CHHHHHHHHHHHHHHHH
Q psy13955         53 TTREKLHSEVILTWVSN   69 (74)
Q Consensus        53 ~~~d~~~s~~~~~~w~n   69 (74)
                      -++.+.++++++.+|.+
T Consensus        51 l~~Q~~l~~ril~hW~~   67 (185)
T PF09936_consen   51 LEAQRELAERILGHWQE   67 (185)
T ss_dssp             -HHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHhccc
Confidence            46778999999999975


No 19 
>PF07888 CALCOCO1:  Calcium binding and coiled-coil domain (CALCOCO1) like;  InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1 (Q61026 from SWISSPROT), and thus enhances transcriptional activation by a number of nuclear receptors. CoCoA has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region []. 
Probab=20.86  E-value=43  Score=24.54  Aligned_cols=25  Identities=28%  Similarity=0.741  Sum_probs=21.4

Q ss_pred             EEEecCCCCCCCCCcCchhhhcCCc
Q psy13955         16 IYLFCPLETDQSVSGEEVPYFLGVP   40 (74)
Q Consensus        16 ~Y~f~~~~~~Ga~H~~dl~y~F~~~   40 (74)
                      +|.|.|-.-.|...|.-.||.|..|
T Consensus        89 ~YqfcYv~~~g~V~G~S~pFqf~~~  113 (546)
T PF07888_consen   89 FYQFCYVDQKGEVRGASTPFQFRAP  113 (546)
T ss_pred             eEEEEEECCCccEEEecCCcccCCC
Confidence            6888887777989999999999865


No 20 
>PF11294 DUF3095:  Protein of unknown function (DUF3095);  InterPro: IPR021445  Some members in this bacterial family of proteins are annotated as adenylyl cyclase however this cannot be confirmed. Currently no function is known. 
Probab=20.60  E-value=1.2e+02  Score=21.20  Aligned_cols=13  Identities=23%  Similarity=0.800  Sum_probs=11.0

Q ss_pred             CCCcCchhhhcCC
Q psy13955         27 SVSGEEVPYFLGV   39 (74)
Q Consensus        27 a~H~~dl~y~F~~   39 (74)
                      +..+.|+||+||-
T Consensus        63 ~~~~~~~PFvFGG   75 (373)
T PF11294_consen   63 ALGGRDFPFVFGG   75 (373)
T ss_pred             cccCCCCCeEecC
Confidence            4578999999984


No 21 
>PF08588 DUF1769:  Protein of unknown function (DUF1769);  InterPro: IPR013897 This entry is found in fungal proteins with unknown function. 
Probab=20.21  E-value=1.4e+02  Score=15.09  Aligned_cols=8  Identities=25%  Similarity=0.559  Sum_probs=5.1

Q ss_pred             hcCCcCCC
Q psy13955         36 FLGVPLDG   43 (74)
Q Consensus        36 ~F~~~~~~   43 (74)
                      +||+-+..
T Consensus         5 ~FGndFd~   12 (56)
T PF08588_consen    5 LFGNDFDR   12 (56)
T ss_pred             eecCccCc
Confidence            67776653


No 22 
>PF03369 Herpes_UL3:  Herpesvirus UL3 protein;  InterPro: IPR005035 Herpes simplex viruses are large DNA viruses, the genome of which encode approximately 80 genes. The UL3 gene of Human herpesvirus 2 (HHV-2) is predicted to encode a 233 amino acid protein with a molecular mass of 26 kDa. Homologues of the UL3 protein are encoded only among alphaherpesviruses. The function of the UL3 protein of Herpes simplex viruses remains unknown but it is known to localize to the nucleus and is a phosphoprotein [].
Probab=20.14  E-value=67  Score=19.04  Aligned_cols=11  Identities=18%  Similarity=0.407  Sum_probs=9.2

Q ss_pred             CCeeEEEecCC
Q psy13955         12 CGGIIYLFCPL   22 (74)
Q Consensus        12 ~~~y~Y~f~~~   22 (74)
                      .|||.|+|.-.
T Consensus       112 VPVfv~EF~a~  122 (134)
T PF03369_consen  112 VPVFVYEFSAV  122 (134)
T ss_pred             ceEEEEEEecc
Confidence            68999999853


Done!