Query         psy13956
Match_columns 83
No_of_seqs    156 out of 1027
Neff          8.7 
Searched_HMMs 46136
Date          Fri Aug 16 15:53:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13956.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13956hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4389|consensus               99.8 2.9E-21 6.3E-26  134.0   5.8   73    2-83    436-508 (601)
  2 cd00312 Esterase_lipase Estera  99.7 1.1E-17 2.4E-22  116.3   7.0   67    9-83    394-460 (493)
  3 PF00135 COesterase:  Carboxyle  99.7   4E-17 8.6E-22  113.5   4.0   74    3-83    422-495 (535)
  4 COG2272 PnbA Carboxylesterase   99.5 4.4E-14 9.6E-19   98.5   6.7   68    8-83    377-444 (491)
  5 KOG1516|consensus               98.6 1.7E-07 3.7E-12   66.4   6.7   72    4-83    427-499 (545)
  6 COG2238 RPS19A Ribosomal prote  53.2     5.9 0.00013   24.2   0.5    9   75-83     30-38  (147)
  7 PF10071 DUF2310:  Zn-ribbon-co  43.2      26 0.00056   23.5   2.4   17    5-21    196-212 (258)
  8 PRK09333 30S ribosomal protein  31.7      17 0.00037   22.4   0.2    9   75-83     30-38  (150)
  9 PF13869 NUDIX_2:  Nucleotide h  31.6     8.7 0.00019   24.5  -1.1   22   62-83     20-41  (188)
 10 PF03369 Herpes_UL3:  Herpesvir  28.5      38 0.00082   20.3   1.2   13    7-19    109-121 (134)
 11 PF09236 AHSP:  Alpha-haemoglob  27.5   1E+02  0.0022   17.3   2.7   10   70-79     34-43  (89)
 12 KOG2350|consensus               27.5      54  0.0012   21.3   1.9   14   68-81    144-157 (221)
 13 KOG1689|consensus               26.6      43 0.00094   21.3   1.3   22   62-83     46-67  (221)
 14 TIGR03068 srtB_sig_NPQTN sorta  26.4      18 0.00038   16.5  -0.3   10    7-16      5-14  (33)
 15 PF11294 DUF3095:  Protein of u  26.4      88  0.0019   22.2   2.9   14   36-49     63-76  (373)
 16 PF09936 Methyltrn_RNA_4:  SAM-  25.6      89  0.0019   20.0   2.6   17   62-78     51-67  (185)
 17 PF14293 YWFCY:  YWFCY protein   25.6      65  0.0014   16.8   1.7   13   71-83     45-57  (61)
 18 cd02639 R3H_RRM R3H domain of   25.1 1.1E+02  0.0024   15.7   2.7   19   58-76     23-41  (60)
 19 PHA01816 hypothetical protein   24.8      83  0.0018   18.8   2.2   23   59-81     33-55  (160)
 20 PF01090 Ribosomal_S19e:  Ribos  23.7      25 0.00055   21.4  -0.1    9   75-83     29-37  (139)
 21 PF02315 MDH:  Methanol dehydro  21.7   1E+02  0.0022   17.4   2.1   17   67-83     68-84  (93)
 22 PTZ00095 40S ribosomal protein  21.5      34 0.00073   21.5   0.2    8   76-83     55-62  (169)
 23 PF14475 Mso1_Sec1_bdg:  Sec1-b  21.4      98  0.0021   14.8   1.7   17   62-78     16-32  (41)
 24 COG5595 Zn-ribbon-containing,   20.2      93   0.002   20.4   1.9   16    3-18    192-207 (256)

No 1  
>KOG4389|consensus
Probab=99.84  E-value=2.9e-21  Score=133.95  Aligned_cols=73  Identities=29%  Similarity=0.424  Sum_probs=64.2

Q ss_pred             hhHhhhcCCCeEEEEecCCCCcCcCCCCCCCCCCCCCCCCchhhcCCcCCCCCCCcCCCCCHHHHHHHHHHHHHHHhhhc
Q psy13956          2 LKAQKRLGSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFAR   81 (83)
Q Consensus         2 ~~~~~~~~~~~y~Y~f~~~~~~~~~~~~~~~~~Ga~H~~dl~yvF~~~~~~~~~~~~~~~~~~d~~~s~~m~~~w~nFAk   81 (83)
                      +.+.+..|+.||+|.|+|    +++....|+|+||.||.||-|+||.|+..     ..+++++|+.+|++||++|+||||
T Consensus       436 A~~~~~~g~~v~~YyFth----rsSa~pWP~WmGVmHGYEIEyvFG~PL~~-----s~nYt~~E~~ls~rim~~WanFAk  506 (601)
T KOG4389|consen  436 ADALAEQGASVYYYYFTH----RSSANPWPKWMGVMHGYEIEYVFGIPLNY-----SRNYTKEEKILSRRIMRYWANFAK  506 (601)
T ss_pred             HHHHHHhcCcEEEEEEec----cccCCCchhhhcCcccceEEEEecccccc-----cccccHHHHHHHHHHHHHHHHHhh
Confidence            456677888999999999    55555678999999999999999999862     468899999999999999999999


Q ss_pred             cC
Q psy13956         82 SG   83 (83)
Q Consensus        82 tG   83 (83)
                      ||
T Consensus       507 tG  508 (601)
T KOG4389|consen  507 TG  508 (601)
T ss_pred             cC
Confidence            98


No 2  
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.
Probab=99.73  E-value=1.1e-17  Score=116.32  Aligned_cols=67  Identities=24%  Similarity=0.333  Sum_probs=52.1

Q ss_pred             CCCeEEEEecCCCCcCcCCCCCCCCCCCCCCCCchhhcCCcCCCCCCCcCCCCCHHHHHHHHHHHHHHHhhhccC
Q psy13956          9 GSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG   83 (83)
Q Consensus         9 ~~~~y~Y~f~~~~~~~~~~~~~~~~~Ga~H~~dl~yvF~~~~~~~~~~~~~~~~~~d~~~s~~m~~~w~nFAktG   83 (83)
                      +.|||+|+|+|......  ...+.+.||+|++||+|||+++...      ...+++|++|++.|+++|+||||+|
T Consensus       394 ~~~vY~Y~F~~~~~~~~--~~~~~~~Ga~H~~Dl~ylFg~~~~~------~~~~~~d~~ls~~m~~~w~nFaktG  460 (493)
T cd00312         394 GSPVYAYVFDHRSSLSV--GRWPPWLGTVHGDEIFFVFGNPLLK------EGLREEEEKLSRTMMKYWANFAKTG  460 (493)
T ss_pred             CCCeEEEEeccCCcCCc--cccCCCCCcccCCceeeecCCCCCC------CCCCcHHHHHHHHHHHHHHHHhhhC
Confidence            78999999999543211  0124678999999999999986532      1225789999999999999999998


No 3  
>PF00135 COesterase:  Carboxylesterase family The prints entry is specific to acetylcholinesterase;  InterPro: IPR002018 Higher eukaryotes have many distinct esterases. Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
Probab=99.67  E-value=4e-17  Score=113.48  Aligned_cols=74  Identities=19%  Similarity=0.302  Sum_probs=57.2

Q ss_pred             hHhhhcCCCeEEEEecCCCCcCcCCCCCCCCCCCCCCCCchhhcCCcCCCCCCCcCCCCCHHHHHHHHHHHHHHHhhhcc
Q psy13956          3 KAQKRLGSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARS   82 (83)
Q Consensus         3 ~~~~~~~~~~y~Y~f~~~~~~~~~~~~~~~~~Ga~H~~dl~yvF~~~~~~~~~~~~~~~~~~d~~~s~~m~~~w~nFAkt   82 (83)
                      ...++.+.|+|+|+|+|....  .....+.+.||+|++||+|||+.+....     ...+++|+.+++.|+++|+||||+
T Consensus       422 ~~~~~~~~~vY~Y~F~~~~~~--~~~~~~~~~ga~H~~Dl~ylFg~~~~~~-----~~~~~~~~~ls~~m~~~w~nFak~  494 (535)
T PF00135_consen  422 NHLASGGSPVYLYRFDYPPPF--IFSPDPPWRGACHGDDLPYLFGNPFLSP-----PNPTEDDRKLSDQMQRYWTNFAKT  494 (535)
T ss_dssp             HHHHHTTSCEEEEEEHHSSTT--STECSETTGTSBTTTTHHHHTTGCCHCH-----HHTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccccccceeeccccccc--ccccccccccccchhhhhhhcCCCcccc-----cccccHHHHHHHHHHHHHHhcCCC
Confidence            345667789999999995432  1122346789999999999999876531     112789999999999999999999


Q ss_pred             C
Q psy13956         83 G   83 (83)
Q Consensus        83 G   83 (83)
                      |
T Consensus       495 G  495 (535)
T PF00135_consen  495 G  495 (535)
T ss_dssp             S
T ss_pred             C
Confidence            7


No 4  
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism]
Probab=99.51  E-value=4.4e-14  Score=98.47  Aligned_cols=68  Identities=16%  Similarity=0.080  Sum_probs=52.9

Q ss_pred             cCCCeEEEEecCCCCcCcCCCCCCCCCCCCCCCCchhhcCCcCCCCCCCcCCCCCHHHHHHHHHHHHHHHhhhccC
Q psy13956          8 LGSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG   83 (83)
Q Consensus         8 ~~~~~y~Y~f~~~~~~~~~~~~~~~~~Ga~H~~dl~yvF~~~~~~~~~~~~~~~~~~d~~~s~~m~~~w~nFAktG   83 (83)
                      .+.|+|+|+|+|..    . .......||+|+.||++|||+....   ......+++++++|++|...|.||||+|
T Consensus       377 ~~ap~w~Yrf~~~~----~-~~~~~~~gA~H~~El~~Vfg~~~~~---~~~~~~~~~~~~~s~~~~~~w~nFArtg  444 (491)
T COG2272         377 AGAPTWLYRFDYAP----D-TVRVPGFGAPHATELSLVFGNLVAL---GSAAQTARATAKLSRQMQDAWANFARTG  444 (491)
T ss_pred             cCCCeeEEEeccCC----c-ccccccCCCccccceeeeecccccc---ccccccchHHHHHHHHHHHHHHHHHhcC
Confidence            46899999999933    1 1124567999999999999987621   1233447778899999999999999997


No 5  
>KOG1516|consensus
Probab=98.60  E-value=1.7e-07  Score=66.39  Aligned_cols=72  Identities=14%  Similarity=0.193  Sum_probs=49.2

Q ss_pred             HhhhcCCCeEEEEecCCCCcCcCCCC-CCCCCCCCCCCCchhhcCCcCCCCCCCcCCCCCHHHHHHHHHHHHHHHhhhcc
Q psy13956          4 AQKRLGSRTAVVDNNSNTEKRRKNTR-KPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARS   82 (83)
Q Consensus         4 ~~~~~~~~~y~Y~f~~~~~~~~~~~~-~~~~~Ga~H~~dl~yvF~~~~~~~~~~~~~~~~~~d~~~s~~m~~~w~nFAkt   82 (83)
                      .+.+.+.++|+|.|+|.......... .....|+.|++|+.|+|+.+....    ....+..|..+    +.+|+|||++
T Consensus       427 ~~~~~~~~~~~y~f~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~----~~~~~~~~~~~----~~~~~~fa~~  498 (545)
T KOG1516|consen  427 LRREYGNPVYLYSFDYDNPVNFGRPGEKDPDTGVEHADDLRYLFGENFLKR----PVMKSSFEKKL----IELWTNFAKT  498 (545)
T ss_pred             HHHhcCCCeEEEEEEecCcccccccccccCccCCcccccceeecccccccc----CCCCChHHHHH----HHHHHHHHhh
Confidence            34445579999999996543222111 234569999999999999865421    22335666665    9999999998


Q ss_pred             C
Q psy13956         83 G   83 (83)
Q Consensus        83 G   83 (83)
                      |
T Consensus       499 g  499 (545)
T KOG1516|consen  499 G  499 (545)
T ss_pred             C
Confidence            7


No 6  
>COG2238 RPS19A Ribosomal protein S19E (S16A) [Translation, ribosomal structure and biogenesis]
Probab=53.18  E-value=5.9  Score=24.21  Aligned_cols=9  Identities=11%  Similarity=0.309  Sum_probs=8.0

Q ss_pred             HHHhhhccC
Q psy13956         75 WVSNFARSG   83 (83)
Q Consensus        75 ~w~nFAktG   83 (83)
                      -|++|+|||
T Consensus        30 ~wa~~vKTG   38 (147)
T COG2238          30 EWADIVKTG   38 (147)
T ss_pred             hhhhhhhcc
Confidence            399999998


No 7  
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=43.19  E-value=26  Score=23.53  Aligned_cols=17  Identities=18%  Similarity=-0.064  Sum_probs=13.3

Q ss_pred             hhhcCCCeEEEEecCCC
Q psy13956          5 QKRLGSRTAVVDNNSNT   21 (83)
Q Consensus         5 ~~~~~~~~y~Y~f~~~~   21 (83)
                      .+..+.|||+|.|.+-+
T Consensus       196 e~~T~iPtYYyLyrv~g  212 (258)
T PF10071_consen  196 EKLTGIPTYYYLYRVGG  212 (258)
T ss_pred             HHHhCCCeEEEEEEccC
Confidence            35568899999999744


No 8  
>PRK09333 30S ribosomal protein S19e; Provisional
Probab=31.68  E-value=17  Score=22.40  Aligned_cols=9  Identities=22%  Similarity=0.438  Sum_probs=7.6

Q ss_pred             HHHhhhccC
Q psy13956         75 WVSNFARSG   83 (83)
Q Consensus        75 ~w~nFAktG   83 (83)
                      =|++|+|||
T Consensus        30 ~W~~~vKTg   38 (150)
T PRK09333         30 EWAAFVKTG   38 (150)
T ss_pred             cchhhhccc
Confidence            499999987


No 9  
>PF13869 NUDIX_2:  Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A ....
Probab=31.56  E-value=8.7  Score=24.51  Aligned_cols=22  Identities=9%  Similarity=0.259  Sum_probs=17.1

Q ss_pred             CHHHHHHHHHHHHHHHhhhccC
Q psy13956         62 TTREKLHSEVILTWVSNFARSG   83 (83)
Q Consensus        62 ~~~d~~~s~~m~~~w~nFAktG   83 (83)
                      .++|..+.+++.++-.+|.+.|
T Consensus        20 ~ekd~s~~~rl~rl~~~y~~~G   41 (188)
T PF13869_consen   20 PEKDPSVAARLQRLKENYEKEG   41 (188)
T ss_dssp             --SSSSHHHHHHHHHHHHHHHS
T ss_pred             cccccCHHHHHHHHHHHHHHhC
Confidence            3456678899999999999887


No 10 
>PF03369 Herpes_UL3:  Herpesvirus UL3 protein;  InterPro: IPR005035 Herpes simplex viruses are large DNA viruses, the genome of which encode approximately 80 genes. The UL3 gene of Human herpesvirus 2 (HHV-2) is predicted to encode a 233 amino acid protein with a molecular mass of 26 kDa. Homologues of the UL3 protein are encoded only among alphaherpesviruses. The function of the UL3 protein of Herpes simplex viruses remains unknown but it is known to localize to the nucleus and is a phosphoprotein [].
Probab=28.46  E-value=38  Score=20.28  Aligned_cols=13  Identities=8%  Similarity=-0.036  Sum_probs=10.1

Q ss_pred             hcCCCeEEEEecC
Q psy13956          7 RLGSRTAVVDNNS   19 (83)
Q Consensus         7 ~~~~~~y~Y~f~~   19 (83)
                      +...|||+|+|.-
T Consensus       109 ~P~VPVfv~EF~a  121 (134)
T PF03369_consen  109 HPAVPVFVYEFSA  121 (134)
T ss_pred             CCcceEEEEEEec
Confidence            3456999999965


No 11 
>PF09236 AHSP:  Alpha-haemoglobin stabilising protein;  InterPro: IPR015317 Alpha-haemoglobin stabilising protein (AHSP) acts a molecular chaperone for free alpha-haemoglobin, preventing the harmful aggregation of alpha-haemoglobin during normal erythroid cell development: it specifically protects free alpha-haemoglobin from precipitation. AHSP adopts a helical secondary structure consisting of an elongated antiparallel three alpha-helix bundle []. ; GO: 0030492 hemoglobin binding, 0006457 protein folding, 0020027 hemoglobin metabolic process, 0030097 hemopoiesis, 0050821 protein stabilization; PDB: 1Y01_A 1XZY_A 3OVU_A 1W0A_A 3IA3_C 1Z8U_A 1W0B_A 1W09_A.
Probab=27.54  E-value=1e+02  Score=17.27  Aligned_cols=10  Identities=20%  Similarity=0.185  Sum_probs=7.6

Q ss_pred             HHHHHHHHhh
Q psy13956         70 EVILTWVSNF   79 (83)
Q Consensus        70 ~~m~~~w~nF   79 (83)
                      ..+++=|+||
T Consensus        34 vtvV~Dwvnf   43 (89)
T PF09236_consen   34 VTVVNDWVNF   43 (89)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            5677888887


No 12 
>KOG2350|consensus
Probab=27.52  E-value=54  Score=21.27  Aligned_cols=14  Identities=14%  Similarity=0.342  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHhhhc
Q psy13956         68 HSEVILTWVSNFAR   81 (83)
Q Consensus        68 ~s~~m~~~w~nFAk   81 (83)
                      -.+++|.+|-.|+|
T Consensus       144 ~ekr~mkLWNsfVr  157 (221)
T KOG2350|consen  144 GEKRVMKLWNSFVR  157 (221)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35789999999987


No 13 
>KOG1689|consensus
Probab=26.62  E-value=43  Score=21.31  Aligned_cols=22  Identities=5%  Similarity=0.213  Sum_probs=18.0

Q ss_pred             CHHHHHHHHHHHHHHHhhhccC
Q psy13956         62 TTREKLHSEVILTWVSNFARSG   83 (83)
Q Consensus        62 ~~~d~~~s~~m~~~w~nFAktG   83 (83)
                      -+.|..+++++.++=.+|-|-|
T Consensus        46 ~eKD~svadrf~rmk~ey~k~g   67 (221)
T KOG1689|consen   46 REKDESVADRFARMKIEYMKEG   67 (221)
T ss_pred             hhccchHHHHHHHHHHHHHhhh
Confidence            5678889999999988887765


No 14 
>TIGR03068 srtB_sig_NPQTN sortase B signal domain, NPQTN class. This model represents one of the boutique (rare) sortase signals, recognized by sortase B (SrtB) rather than by the housekeeping-type SrtA class sortase. This sequence, beginning NPQTN, shows little similarity to several other SrtB substrates.
Probab=26.44  E-value=18  Score=16.48  Aligned_cols=10  Identities=10%  Similarity=0.215  Sum_probs=5.3

Q ss_pred             hcCCCeEEEE
Q psy13956          7 RLGSRTAVVD   16 (83)
Q Consensus         7 ~~~~~~y~Y~   16 (83)
                      ..+.|+|.|.
T Consensus         5 s~gtp~y~y~   14 (33)
T TIGR03068         5 NAGTPAYIYA   14 (33)
T ss_pred             CCCCcchhhH
Confidence            3445666653


No 15 
>PF11294 DUF3095:  Protein of unknown function (DUF3095);  InterPro: IPR021445  Some members in this bacterial family of proteins are annotated as adenylyl cyclase however this cannot be confirmed. Currently no function is known. 
Probab=26.43  E-value=88  Score=22.19  Aligned_cols=14  Identities=21%  Similarity=0.726  Sum_probs=11.9

Q ss_pred             CCCCCCchhhcCCc
Q psy13956         36 SVSGEEVPYFLGVP   49 (83)
Q Consensus        36 a~H~~dl~yvF~~~   49 (83)
                      +..+.|+|||||.-
T Consensus        63 ~~~~~~~PFvFGGD   76 (373)
T PF11294_consen   63 ALGGRDFPFVFGGD   76 (373)
T ss_pred             cccCCCCCeEecCC
Confidence            56899999999963


No 16 
>PF09936 Methyltrn_RNA_4:  SAM-dependent RNA methyltransferase;  InterPro: IPR019230  This entry contains proteins that have no known function. They are found as separate proteins and as a C-terminal domain to tRNA (guanine-N(1)-)-methyltransferases to which they are structurally related. ; PDB: 3DCM_X.
Probab=25.60  E-value=89  Score=19.99  Aligned_cols=17  Identities=18%  Similarity=0.100  Sum_probs=14.2

Q ss_pred             CHHHHHHHHHHHHHHHh
Q psy13956         62 TTREKLHSEVILTWVSN   78 (83)
Q Consensus        62 ~~~d~~~s~~m~~~w~n   78 (83)
                      -++.++|+++++++|.+
T Consensus        51 l~~Q~~l~~ril~hW~~   67 (185)
T PF09936_consen   51 LEAQRELAERILGHWQE   67 (185)
T ss_dssp             -HHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHhccc
Confidence            46788999999999985


No 17 
>PF14293 YWFCY:  YWFCY protein
Probab=25.55  E-value=65  Score=16.82  Aligned_cols=13  Identities=38%  Similarity=0.606  Sum_probs=7.9

Q ss_pred             HHHHHHHhhhccC
Q psy13956         71 VILTWVSNFARSG   83 (83)
Q Consensus        71 ~m~~~w~nFAktG   83 (83)
                      ..-++..||.|||
T Consensus        45 v~DrIL~n~~rt~   57 (61)
T PF14293_consen   45 VVDRILLNFQRTG   57 (61)
T ss_pred             HHHHHHHHHHhhc
Confidence            3345667777765


No 18 
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=25.13  E-value=1.1e+02  Score=15.69  Aligned_cols=19  Identities=11%  Similarity=0.162  Sum_probs=14.3

Q ss_pred             CCCCCHHHHHHHHHHHHHH
Q psy13956         58 KSKYTTREKLHSEVILTWV   76 (83)
Q Consensus        58 ~~~~~~~d~~~s~~m~~~w   76 (83)
                      +...+++++++...+..-+
T Consensus        23 p~~ls~~eRriih~la~~l   41 (60)
T cd02639          23 PSSLSPAERRIVHLLASRL   41 (60)
T ss_pred             CCCCCHHHHHHHHHHHHHc
Confidence            4566999999888877654


No 19 
>PHA01816 hypothetical protein
Probab=24.83  E-value=83  Score=18.80  Aligned_cols=23  Identities=17%  Similarity=0.200  Sum_probs=18.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhhc
Q psy13956         59 SKYTTREKLHSEVILTWVSNFAR   81 (83)
Q Consensus        59 ~~~~~~d~~~s~~m~~~w~nFAk   81 (83)
                      .++.-+|+.+.+..++.|-.|+.
T Consensus        33 infkfddkdlqeayid~wkhf~h   55 (160)
T PHA01816         33 VNFKFDDKDLQEAYIDTWKHFAH   55 (160)
T ss_pred             CccccChhHHHHHHHHHHHHhhc
Confidence            34456678888999999999974


No 20 
>PF01090 Ribosomal_S19e:  Ribosomal protein S19e;  InterPro: IPR001266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family includes a number of eukaryotic and archaebacterial ribosomal proteins; mammalian S19, Drosophila S19, Ascaris lumbricoides S19g (ALEP-1) and S19s, yeast YS16 (RP55A and RP55B), Aspergillus S16 and Haloarcula marismortui HS12.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_S 3U5G_T 3U5C_T 3O30_M 3O2Z_M 3IZB_S 2XZN_T 2XZM_T 2V7F_A.
Probab=23.73  E-value=25  Score=21.35  Aligned_cols=9  Identities=11%  Similarity=0.309  Sum_probs=7.3

Q ss_pred             HHHhhhccC
Q psy13956         75 WVSNFARSG   83 (83)
Q Consensus        75 ~w~nFAktG   83 (83)
                      -|++|+|||
T Consensus        29 ~w~d~vKTg   37 (139)
T PF01090_consen   29 EWADIVKTG   37 (139)
T ss_dssp             SCGGGTSSS
T ss_pred             chHHHHhhc
Confidence            488888887


No 21 
>PF02315 MDH:  Methanol dehydrogenase beta subunit;  InterPro: IPR003420 Methanol dehydrogenase (MDH) (1.1.99.8 from EC), found in Gram-negative bacteria, is a pyrroloquinoline quinone (PQQ)-containing enzyme which oxidises methanol to formaldehyde. It is located in the periplasmic space and passes electrons derived from the oxidation of methanol to the soluble cytochrome cL []. The enzyme is a tetramer composed of two large alpha subunits and two smaller beta subunits. The alpha subunit binds the PQQ cofactor and contains the active site, while the function of the beta subunit is currently unknown []. The alpha subunit forms an eight-bladed propeller structure, with several novel tryptophan-docking motifs linking the individual blades together. This entry represents the beta subunit of methanol dehydrogenase.; GO: 0004022 alcohol dehydrogenase (NAD) activity, 0015946 methanol oxidation, 0055114 oxidation-reduction process; PDB: 1LRW_B 2D0V_J 2AD6_B 1G72_B 4AAH_D 2AD8_D 2AD7_D 1H4J_D 1H4I_B 1W6S_B ....
Probab=21.67  E-value=1e+02  Score=17.36  Aligned_cols=17  Identities=29%  Similarity=0.366  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHhhhccC
Q psy13956         67 LHSEVILTWVSNFARSG   83 (83)
Q Consensus        67 ~~s~~m~~~w~nFAktG   83 (83)
                      .|-+|=..-+.||.+||
T Consensus        68 ~me~RN~kR~~~fkkTG   84 (93)
T PF02315_consen   68 AMEERNAKRVENFKKTG   84 (93)
T ss_dssp             HHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHhcC
Confidence            45666677899999998


No 22 
>PTZ00095 40S ribosomal protein S19; Provisional
Probab=21.52  E-value=34  Score=21.55  Aligned_cols=8  Identities=0%  Similarity=0.339  Sum_probs=6.9

Q ss_pred             HHhhhccC
Q psy13956         76 VSNFARSG   83 (83)
Q Consensus        76 w~nFAktG   83 (83)
                      |++|+|||
T Consensus        55 W~d~vKTg   62 (169)
T PTZ00095         55 CTEIVKTS   62 (169)
T ss_pred             chhhhccc
Confidence            88899887


No 23 
>PF14475 Mso1_Sec1_bdg:  Sec1-binding region of Mso1
Probab=21.41  E-value=98  Score=14.81  Aligned_cols=17  Identities=12%  Similarity=0.212  Sum_probs=14.6

Q ss_pred             CHHHHHHHHHHHHHHHh
Q psy13956         62 TTREKLHSEVILTWVSN   78 (83)
Q Consensus        62 ~~~d~~~s~~m~~~w~n   78 (83)
                      +++|.-+++.|++|..+
T Consensus        16 teddT~v~r~l~~yY~~   32 (41)
T PF14475_consen   16 TEDDTHVHRVLRKYYTE   32 (41)
T ss_pred             CcchhHHHHHHHHHHHH
Confidence            78899999999998764


No 24 
>COG5595 Zn-ribbon-containing, possibly nucleic-acid-binding protein [General function prediction only]
Probab=20.16  E-value=93  Score=20.35  Aligned_cols=16  Identities=19%  Similarity=0.007  Sum_probs=12.6

Q ss_pred             hHhhhcCCCeEEEEec
Q psy13956          3 KAQKRLGSRTAVVDNN   18 (83)
Q Consensus         3 ~~~~~~~~~~y~Y~f~   18 (83)
                      +.++..+.|||+|.+.
T Consensus       192 rIek~t~iptyYylyr  207 (256)
T COG5595         192 RIEKCTGIPTYYYLYR  207 (256)
T ss_pred             HHHHHhCCCceEEEEE
Confidence            3456678899999997


Done!