Diaphorina citri psyllid: psy13975


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----
MTNPYYDVFVLRFNDGSVIGNILLISDNSSGKTTLIAKLQGIDSPEKGLALEYAYINVSDEYREDHTRLGVWILDGEPAHSNLLRFALNQETLPHTMVMLVVSMTTPWNIIDELHNWASVLQDHIDSLNIGAHDYQAGRCCKLLTFARLRAHLIELLSFYLFYSSVSVIPGEGILERNLGVDIVVVVTKTDYMSTLEKDFYYKEEHFDFVQQYIRKFCLKFGAGLFYTSAKEDKNCDLLYKYLAHRLYGFPFRTSALIVEKDAVLIPSGWDNMKKIGILYENMQSIKPDDYYTDVITKPIVRKPISREQDTLVEDEQSFLARQLALLQQNPAANPTTRQDNSLPQIRTPVGVQKTGDRRLSNSPAMQGGGANSPKKMIDPTKVGATTPGGEGVLASFFNSLLLKKTAQSPLSKSN
cccHHHHHHHHccccccccEEEEEEccccccccHHHHHHccccccccccccEEEEEEEcccccccccEEEEEEcccccccHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHcccccccccEEECcccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccc
**NPYYDVFVLRFNDGSVIGNILLISDNSSGKTTLIAKLQGIDSPEKGLALEYAYINVSDEYREDHTRLGVWILDGEPAHSNLLRFALNQETLPHTMVMLVVSMTTPWNIIDELHNWASVLQDHIDSLNIGAHDYQAGRCCKLLTFARLRAH*************VSVIPGEGILERNLGVDIVVVVTKTDYMSTLEKDFYYKEEHFDFVQQYIRKFCLKFGAGLFYTSAKEDKNCDLLYKYLAHRLYGFPFRTSALIVEKDAVLIPSGWDNMKKIGILYENMQSIKPDDYYTDVITKPIVR**********************************************************************************************FF*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNPYYDVFVLRFNDGSVIGNILLISDNSSGKTTLIAKLQGIDSPEKGLALEYAYINVSDEYREDHTRLGVWILDGEPAHSNLLRFALNQETLPHTMVMLVVSMTTPWNIIDELHNWASVLQDHIDSLNIGAHDYQAGRCCKLLTFARLRAHLIELLSFYLFYSSVSVIPGEGILERNLGVDIVVVVTKTDYMSTLEKDFYYKEEHFDFVQQYIRKFCLKFGAGLFYTSAKEDKNCDLLYKYLAHRLYGFPFRTSALIVEKDAVLIPSGWDNMKKIGILYENMQSIKPDDYYTDVITKPIVRKPISREQDTLVEDEQSFLARQLALLQQNPAANPTTRQDNSLPQIRTPVGVQKTGDRRLSNSPAMQGGGANSPKKMIDPTKVGATTPGGEGVLASFFNSLLLKKTAQSPLSKSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic dynein 1 light intermediate chain 1 Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes. Probably involved in the microtubule-dependent transport of pericentrin. Is required for progress throuh the spindle assembly checkpoint. The phosphorylated form appears to be involved in the selective removal of MAD1L1 and MAD1L2 but not BUB1B from kinetochores.confidentQ9QXU8
Cytoplasmic dynein 1 light intermediate chain 2 Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes.confidentQ5RE09
Cytoplasmic dynein 1 light intermediate chain 2 Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes.confidentQ6PDL0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0035371 [CC]microtubule plus endprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005868 [CC]cytoplasmic dynein complexprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0043226, GO:0044424, GO:0030286, GO:0043228, GO:0005875, GO:0044422
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0003674 [MF]molecular_functionprobable
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0008088 [BP]axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0048814 [BP]regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0046605 [BP]regulation of centrosome cycleprobableGO:0051726, GO:0051493, GO:0033043, GO:0010564, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0032886, GO:0070507, GO:0050789
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TQ4, chain A
Confidence level:confident
Coverage over the Query: 4-55,68-146,179-247
View the alignment between query and template
View the model in PyMOL
Template: 2HXS, chain A
Confidence level:confident
Coverage over the Query: 20-128,179-252
View the alignment between query and template
View the model in PyMOL
Template: 3QF4, chain B
Confidence level:confident
Coverage over the Query: 3-158,201-232
View the alignment between query and template
View the model in PyMOL
Template: 3QQ5, chain A
Confidence level:confident
Coverage over the Query: 180-320
View the alignment between query and template
View the model in PyMOL