BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy13979
(78 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1IK6|A Chain A, 3d Structure Of The E1beta Subunit Of Pyruvate
Dehydrogenase From The Archeon Pyrobaculum Aerophilum
Length = 369
Score = 25.4 bits (54), Expect = 8.9, Method: Composition-based stats.
Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%)
Query: 21 GFMIGFSVGMATGGL--FGGFNALRYGLRGA-ELLKNVGKVMVQGGGSFGTFMA----IG 73
G ++GF++GMA GL + + GA ELL ++ K+ + GG++ + +G
Sbjct: 108 GGILGFAMGMAMAGLKPVAEIQFVDFIWLGADELLNHIAKLRYRSGGNYKAPLVVRTPVG 167
Query: 74 AGIR 77
+G R
Sbjct: 168 SGTR 171
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.148 0.464
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,434,088
Number of Sequences: 62578
Number of extensions: 92076
Number of successful extensions: 254
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 253
Number of HSP's gapped (non-prelim): 6
length of query: 78
length of database: 14,973,337
effective HSP length: 47
effective length of query: 31
effective length of database: 12,032,171
effective search space: 372997301
effective search space used: 372997301
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)