Diaphorina citri psyllid: psy13988

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
GFSGGRGNSGWANIELLQLEVISKLCGTPTPAVWPAVIKLPLWHTIKPKKIHRRRLREEFSLMPPGALDLLDKMLELDPERRITAEQALKSVWLKNVHPESMPPPQLPTWQDCHELWSKKRRRQLRGDPMEMQAAAPIQSNSTNNSSRPLMEPLAAGGLSLNNFSVSLFTDELVALKKVRLENEKEGFPITAVREIKILRQLNHKNIVNLREIVTDKSDALDFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEVNNASIMRQLLDGLSYCHKRNFLHRDIKCSNILMNNRGEVKLADFGLARLYNAEDRQRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFVKKPLF
ccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHcccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHHcccccccccccEECccccccccccccccEEEEEEccHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEECccccEEEccccccccccccccccccccccCEECccccccccccccccccHHHHHHHHHHHHHHHccccc
********SGWANIELLQLEVISKLCGTPTPAVWPAVIKLPLWHTIKPKKIHRRRLREEFSLMPPGALDLLDKMLELDPERRITAEQALKSVWLKNVHPESMPPPQLPTWQDCHELWSKKRRRQLRGDPMEMQAAAPIQSNSTNNSSRPLMEPLAAGGLSLNNFSVSLFTDELVALKKVRLENEKEGFPITAVREIKILRQLNHKNIVNLREIVTDKSDALDFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEVNNASIMRQLLDGLSYCHKRNFLHRDIKCSNILMNNRGEVKLADFGLARLYNAEDRQRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFVKKPLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GFSGGRGNSGWANIELLQLEVISKLCGTPTPAVWPAVIKLPLWHTIKPKKIHRRRLREEFSLMPPGALDLLDKMLELDPERRITAEQALKSVWLKNVHPESMPPPQLPTWQDCHELWSKKRRRQLRGDPMEMQAAAPIQSNSTNNSSRPLMEPLAAGGLSLNNFSVSLFTDELVALKKVRLENEKEGFPITAVREIKILRQLNHKNIVNLREIVTDKSDALDFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEVNNASIMRQLLDGLSYCHKRNFLHRDIKCSNILMNNRGEVKLADFGLARLYNAEDRQRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFVKKPLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinase 12 Cyclin-dependent kinase which displays CTD kinase activity: hyperphosphorylates the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit, thereby acting as a key regulator of transcription elongation.confidentQ9VP22
Cyclin-dependent kinase 13 Cyclin-dependent kinase which displays CTD kinase activity and is required for RNA splicing. Has CTD kinase activity by hyperphosphorylating the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, probably by phosphorylating SRSF1/SF2. Required during hematopoiesis.confidentQ69ZA1
Cyclin-dependent kinase 13 Cyclin-dependent kinase which displays CTD kinase activity and is required for RNA splicing. Has CTD kinase activity by hyperphosphorylating the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, probably by phosphorylating SRSF1/SF2. Required during hematopoiesis. In case of infection by HIV-1 virus, interacts with HIV-1 Tat protein acetylated at 'Lys-50' and 'Lys-51', thereby increasing HIV-1 mRNA splicing and promoting the production of the doubly spliced HIV-1 protein Nef.confidentQ14004

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partconfidentGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044238 [BP]primary metabolic processconfidentGO:0008150, GO:0008152
GO:0005703 [CC]polytene chromosome puffconfidentGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0044260 [BP]cellular macromolecule metabolic processconfidentGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0008353 [MF]RNA polymerase II carboxy-terminal domain kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0002944 [CC]cyclin K-CDK12 complexprobableGO:0043234, GO:0032991, GO:0000307, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0070816 [BP]phosphorylation of RNA polymerase II C-terminal domainprobableGO:0080090, GO:0019222, GO:0016310, GO:0031323, GO:0050789, GO:0044267, GO:0044260, GO:0071704, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0031326, GO:0010468, GO:0006468, GO:0019219, GO:0009987, GO:0009889, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0051171, GO:0008152, GO:2001141, GO:0044238, GO:0019538, GO:0051252, GO:0044237, GO:0043170, GO:0006355, GO:0006796, GO:0010556, GO:0006793
GO:0019908 [CC]nuclear cyclin-dependent protein kinase holoenzyme complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0000307, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0043226, GO:0044424, GO:0043227, GO:0005634, GO:0044422
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000380 [BP]alternative mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0007088 [BP]regulation of mitosisprobableGO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0006282 [BP]regulation of DNA repairprobableGO:0051052, GO:0019222, GO:0060255, GO:0048583, GO:0080134, GO:0080135, GO:0031323, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:2001020, GO:0050789, GO:0080090
GO:0008024 [CC]positive transcription elongation factor complex bprobableGO:0032806, GO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0022414 [BP]reproductive processprobableGO:0008150, GO:0000003
GO:0071157 [BP]negative regulation of cell cycle arrestprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:0010948, GO:0065007, GO:0071156, GO:0048519, GO:0050789, GO:0048523
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0002945 [CC]cyclin K-CDK13 complexprobableGO:0043234, GO:0032991, GO:0000307, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043405 [BP]regulation of MAP kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0023051, GO:0071900, GO:0010627, GO:0050789, GO:0043408, GO:0010646, GO:0009966, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051338, GO:0001932
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0043900 [BP]regulation of multi-organism processprobableGO:0008150, GO:0065007, GO:0050789
GO:0017069 [MF]snRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004693 [MF]cyclin-dependent protein serine/threonine kinase activityprobableGO:0097472, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0051704 [BP]multi-organism processprobableGO:0008150
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0071345 [BP]cellular response to cytokine stimulusprobableGO:0051716, GO:0034097, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0030097 [BP]hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0043111 [BP]replication fork arrestprobableGO:0009892, GO:0051172, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044237, GO:0034645, GO:0090329, GO:0050789, GO:1901360, GO:0051052, GO:0006139, GO:0010605, GO:0019222, GO:0044260, GO:0071704, GO:2000112, GO:2000113, GO:0019219, GO:0006260, GO:0006261, GO:0048519, GO:0051053, GO:0045934, GO:1901576, GO:0060255, GO:0009889, GO:0009987, GO:0006725, GO:0050794, GO:0008156, GO:0009059, GO:0008150, GO:0051171, GO:0008152, GO:0046483, GO:0045005, GO:0044238, GO:0080090, GO:2000104, GO:0065007, GO:0009058, GO:0006275, GO:0043170, GO:0010556, GO:0006259, GO:0010558, GO:0048523
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0031056 [BP]regulation of histone modificationprobableGO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0031323, GO:0051246, GO:0051128, GO:0065007, GO:0031399, GO:0008150, GO:0050794, GO:0050789
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MI9, chain A
Confidence level:very confident
Coverage over the Query: 144-217,228-358
View the alignment between query and template
View the model in PyMOL
Template: 3NIZ, chain A
Confidence level:very confident
Coverage over the Query: 4-98
View the alignment between query and template
View the model in PyMOL
Template: 3FBV, chain A
Confidence level:probable
Coverage over the Query: 145-354
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:probable
Coverage over the Query: 170-214,225-358
View the alignment between query and template
View the model in PyMOL