RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy13989
         (85 letters)



>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 7.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK7 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK7
           plays essential roles in the cell cycle and in
           transcription. It associates with cyclin H and MAT1 and
           acts as a CDK-Activating Kinase (CAK) by phosphorylating
           and activating cell cycle CDKs (CDK1/2/4/6). In the
           brain, it activates CDK5. CDK7 is also a component of
           the general transcription factor TFIIH, which
           phosphorylates the C-terminal domain (CTD) of RNA
           polymerase II when it is bound with unphosphorylated
           DNA, as present in the pre-initiation complex. Following
           phosphorylation, the CTD dissociates from the DNA which
           allows transcription initiation.
          Length = 298

 Score =  127 bits (322), Expect = 6e-38
 Identities = 43/59 (72%), Positives = 52/59 (88%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APELLFGAR YGVG+DMW+VGCI  ELLL+ PFLPG+SD+DQL +IF+ LGTP+E+ WP
Sbjct: 170 APELLFGARHYGVGVDMWSVGCIFAELLLRVPFLPGDSDIDQLGKIFEALGTPTEENWP 228


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score =  112 bits (284), Expect = 2e-32
 Identities = 30/59 (50%), Positives = 45/59 (76%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APE+L G++ Y   +D+W+VGCI  E++   P  PG+S++DQL +IFQ LGTP+E++WP
Sbjct: 166 APEILLGSKHYSTAVDIWSVGCIFAEMITGKPLFPGDSEIDQLFKIFQILGTPTEESWP 224


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score =  105 bits (263), Expect = 3e-29
 Identities = 37/62 (59%), Positives = 49/62 (79%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APELL+GAR Y  G+D+WAVGCI  ELL  +P  PGE+D++QL  +F+TLGTP+E+TW
Sbjct: 166 YRAPELLYGARKYDPGVDLWAVGCIFAELLNGSPLFPGENDIEQLAIVFRTLGTPNEETW 225

Query: 71  PT 72
           P 
Sbjct: 226 PG 227


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score =  102 bits (256), Expect = 2e-28
 Identities = 32/59 (54%), Positives = 43/59 (72%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APELL G + Y   +D+W+VGCI  ELL + P  PG+S++DQL +IF+TLGTP  + WP
Sbjct: 166 APELLLGDKGYSTPVDIWSVGCIFAELLSRRPLFPGKSEIDQLFKIFRTLGTPDPEVWP 224


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
           Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
           Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDC2L1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDC2L1, also
           called PITSLRE, exists in different isoforms which are
           named using the alias CDK11(p). The CDC2L1 gene produces
           two protein products, CDK11(p110) and CDK11(p58). CDC2L1
           is also represented by the caspase-processed CDK11(p46).
           CDK11(p110), the major isoform, associates with cyclin L
           and is expressed throughout the cell cycle. It is
           involved in RNA processing and the regulation of
           transcription. CDK11(p58) associates with cyclin D3 and
           is expressed during the G2/M phase of the cell cycle. It
           plays roles in spindle morphogenesis, centrosome
           maturation, sister chromatid cohesion, and the
           completion of mitosis. CDK11(p46) is formed from the
           larger isoforms by caspases during TNFalpha- and
           Fas-induced apoptosis. It functions as a downstream
           effector kinase in apoptotic signaling pathways and
           interacts with eukaryotic initiation factor 3f (eIF3f), 
           p21-activated kinase (PAK1), and Ran-binding protein
           (RanBPM).
          Length = 293

 Score =  102 bits (257), Expect = 2e-28
 Identities = 36/59 (61%), Positives = 44/59 (74%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APELL GA+ Y   IDMW+VGCI  ELL K P  PG+S++DQL +IF+ LGTP+E  WP
Sbjct: 174 APELLLGAKEYSTAIDMWSVGCIFAELLTKKPLFPGKSEIDQLNKIFKLLGTPTEKIWP 232


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 9-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK9-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK9 and CDK12 from higher eukaryotes, yeast
           BUR1, C-type plant CDKs (CdkC), and similar proteins.
           CDK9, BUR1, and CdkC are functionally equivalent. They
           act as a kinase for the C-terminal domain of RNA
           polymerase II and participate in regulating mutliple
           steps of gene expression including transcription
           elongation and RNA processing. CDK9 and CdkC associate
           with T-type cyclins while BUR1 associates with the
           cyclin BUR2. CDK12 is a unique CDK that contains an
           arginine/serine-rich (RS) domain, which is predominantly
           found in splicing factors. CDK12 interacts with cyclins
           L1 and L2, and participates in regulating transcription
           and alternative splicing.
          Length = 287

 Score = 98.8 bits (247), Expect = 5e-27
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
            PELL GA  YG  +DMW+VGCI+ EL L  P   G ++L+QL +IF+  G+P+++ WP
Sbjct: 169 PPELLLGATRYGPEVDMWSVGCILAELFLGKPIFQGSTELEQLEKIFELCGSPTDENWP 227


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 1-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes, plants, and yeasts, as well as CDK2 and
           CDK3. CDK1 is also called Cell division control protein
           2 (Cdc2) or p34 protein kinase, and is regulated by
           cyclins A, B, and E. The CDK1/cyclin A complex controls
           G2 phase entry and progression while the CDK1/cyclin B
           complex is critical for G2 to M phase transition. CDK2
           is regulated by cyclin E or cyclin A. Upon activation by
           cyclin E, it phosphorylates the retinoblastoma (pRb)
           protein which activates E2F mediated transcription and
           allows cells to move into S phase. The CDK2/cyclin A
           complex plays a role in regulating DNA replication.
           Studies in knockout mice revealed that CDK1 can
           compensate for the loss of the cdk2 gene as it can also
           bind cyclin E and drive G1 to S phase transition. CDK3
           is regulated by cyclin C and it phosphorylates pRB
           specifically during the G0/G1 transition. This
           phosphorylation is required for cells to exit G0
           efficiently and enter the G1 phase.
          Length = 283

 Score = 97.8 bits (244), Expect = 1e-26
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPT 72
           APE+L G+R Y   +D+W++GCI  E++ + P  PG+S++DQL RIF+TLGTP ED WP 
Sbjct: 167 APEILLGSRQYSTPVDIWSIGCIFAEMVNRRPLFPGDSEIDQLFRIFRTLGTPDEDVWP- 225

Query: 73  AGVKGL 78
            GV  L
Sbjct: 226 -GVTSL 230


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 97.1 bits (242), Expect = 5e-26
 Identities = 37/61 (60%), Positives = 44/61 (72%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPT 72
           APELL GA  Y   +DMW+VGCI  ELL   P  PGE+++DQL RIF+ LGTP+ED WP 
Sbjct: 201 APELLMGAEKYHFAVDMWSVGCIFAELLTGKPLFPGENEIDQLGRIFELLGTPNEDNWPQ 260

Query: 73  A 73
           A
Sbjct: 261 A 261


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
           UAS Requirement 1 and similar proteins.
           Serine/Threonine Kinases (STKs), Bypass UAS Requirement
           1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           BUR1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. BUR1, also called
           SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK)
           that is functionally equivalent to mammalian CDK9. It
           associates with the cyclin BUR2. BUR genes were
           orginally identified in a genetic screen as factors
           involved in general transcription. The BUR1/BUR2 complex
           phosphorylates the C-terminal domain of RNA polymerase
           II. In addition, this complex regulates histone
           modification by phosporylating Rad6 and mediating the
           association of the Paf1 complex with chromatin.
          Length = 311

 Score = 90.1 bits (224), Expect = 2e-23
 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPT 72
            PELL G R Y   +D+W +GC+  E+  + P L G+SD+DQL  IF+  GTP+E+TWP 
Sbjct: 194 PPELLLGERRYTTAVDIWGIGCVFAEMFTRRPILQGKSDIDQLHLIFKLCGTPTEETWPG 253

Query: 73  A----GVKGLFS 80
                G +G+ S
Sbjct: 254 WRSLPGCEGVHS 265


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine
           Kinase, Plant B-type Cyclin-Dependent protein Kinase.
           Serine/Threonine Kinases (STKs), Plant B-type
           Cyclin-Dependent protein Kinase (CdkB) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CdkB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. The plant-specific B-type CDKs are expressed
           from the late S to the M phase of the cell cycle. They
           are characterized by the cyclin binding motif
           PPT[A/T]LRE. They play a role in controlling mitosis and
           integrating developmental pathways, such as stomata and
           leaf development. CdkB has been shown to associate with
           both cyclin B, which controls G2/M transition, and
           cyclin D, which acts as a mediator in linking
           extracellular signals to the cell cycle.
          Length = 295

 Score = 89.5 bits (222), Expect = 2e-23
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L G+  Y   +D+W+VGCI  E+  K P  PG+S+L QL  IF+ LGTP+E  W
Sbjct: 177 YRAPEVLLGSTHYSTPVDIWSVGCIFAEMSRKQPLFPGDSELQQLLHIFKLLGTPTEQVW 236

Query: 71  PTAGVKGL 78
           P  GV  L
Sbjct: 237 P--GVSKL 242


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 88.7 bits (220), Expect = 5e-23
 Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 2/68 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L G+R Y   +D+W+VGCI  E++ + P  PG+S++D+L +IF+ LGTP+E+TW
Sbjct: 169 YRAPEILLGSRHYSTPVDIWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTPNEETW 228

Query: 71  PTAGVKGL 78
           P  GV  L
Sbjct: 229 P--GVTSL 234


>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 10.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein Kinase 10 (CDK10) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK10 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK10, also called PISSLRE, is essential for
           cell growth and proliferation, and acts through the G2/M
           phase of the cell cycle. CDK10 has also been identified
           as an important factor in endocrine therapy resistance
           in breast cancer. CDK10 silencing increases the
           transcription of c-RAF and the activation of the p42/p44
           MAPK pathway, which leads to antiestrogen resistance.
           Patients who express low levels of CDK10 relapse early
           on tamoxifen.
          Length = 309

 Score = 87.4 bits (217), Expect = 2e-22
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APELL G   Y   IDMWAVGCI+ ELL   P LPG+S+++QL  I Q LGTP+E  WP
Sbjct: 176 APELLLGCTTYTTAIDMWAVGCILAELLAHKPLLPGKSEIEQLDLIIQLLGTPNESIWP 234


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 1 from higher
           eukaryotes-like.  Serine/Threonine Kinases (STKs),
           Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes. CDK1 is also called Cell division control
           protein 2 (Cdc2) or p34 protein kinase, and is regulated
           by cyclins A, B, and E. The CDK1/cyclin A complex
           controls G2 phase entry and progression. CDK1/cyclin A2
           has also been implicated as an important regulator of S
           phase events. The CDK1/cyclin B complex is critical for
           G2 to M phase transition. It induces mitosis by
           activating nuclear enzymes that regulate chromatin
           condensation, nuclear membrane degradation,
           mitosis-specific microtubule and cytoskeletal
           reorganization. CDK1 also associates with cyclin E and
           plays a role in the entry into S phase. CDK1
           transcription is stable throughout the cell cycle but is
           modulated in some pathological conditions. It may play a
           role in regulating apoptosis under these conditions. In
           breast cancer cells, HER2 can mediate apoptosis by
           inactivating CDK1. Activation of CDK1 may contribute to
           HIV-1 induced apoptosis and neuronal apoptosis in
           neurodegenerative diseases.
          Length = 285

 Score = 86.3 bits (214), Expect = 3e-22
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L G+  Y   +D+W++G I  E+  K P   G+S++DQL RIF+ LGTP+ED W
Sbjct: 167 YRAPEVLLGSPRYSTPVDIWSIGTIFAEMATKKPLFHGDSEIDQLFRIFRILGTPTEDVW 226

Query: 71  PTAGVKGL 78
           P  GV  L
Sbjct: 227 P--GVTSL 232


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK2/3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK2 is regulated by cyclin E or cyclin A.
           Upon activation by cyclin E, it phosphorylates the
           retinoblastoma (pRb) protein which activates E2F
           mediated transcription and allows cells to move into S
           phase. The CDK2/cyclin A complex plays a role in
           regulating DNA replication. CDK2, together with CDK4,
           also regulates embryonic cell proliferation. Despite
           these important roles, mice deleted for the cdk2 gene
           are viable and normal except for being sterile. This may
           be due to compensation provided by CDK1 (also called
           Cdc2), which can also bind cyclin E and drive the G1 to
           S phase transition. CDK3 is regulated by cyclin C and it
           phosphorylates pRB specifically during the G0/G1
           transition. This phosphorylation is required for cells
           to exit G0 efficiently and enter the G1 phase.
          Length = 284

 Score = 86.4 bits (214), Expect = 3e-22
 Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 2/68 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L G + Y   +D+W++GCI  E++ +    PG+S++DQL RIF+TLGTP E  W
Sbjct: 166 YRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVW 225

Query: 71  PTAGVKGL 78
           P  GV  L
Sbjct: 226 P--GVTSL 231


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase (MAPK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The MAPK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAPKs serve as important
           mediators of cellular responses to extracellular
           signals. They control critical cellular functions
           including differentiation, proliferation, migration, and
           apoptosis. They are also implicated in the pathogenesis
           of many diseases including multiple types of cancer,
           stroke, diabetes, and chronic inflammation. Typical MAPK
           pathways involve a triple kinase core cascade comprising
           of the MAPK, which is phosphorylated and activated by a
           MAPK kinase (MAP2K or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAP3K or MKKK). Each cascade is activated either by a
           small GTP-binding protein or by an adaptor protein,
           which transmits the signal either directly to a MAP3K to
           start the triple kinase core cascade or indirectly
           through a mediator kinase, a MAP4K. There are three main
           typical MAPK subfamilies: Extracellular signal-Regulated
           Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
           Some MAPKs are atypical in that they are not regulated
           by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 84.9 bits (211), Expect = 2e-21
 Identities = 29/56 (51%), Positives = 36/56 (64%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APELL  +  Y   ID+W+VGCI  ELL + P  PG   +DQL  I + LGTPSE+
Sbjct: 174 APELLLSSSRYTKAIDIWSVGCIFAELLTRKPLFPGRDYIDQLNLIVEVLGTPSEE 229


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 83.0 bits (206), Expect = 5e-21
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APE+L  +  Y   +D+WA+GCI+ EL    P  PG S++DQL +I   LGTP++  WP
Sbjct: 166 APEILLRSTSYSSPVDIWALGCIMAELYTLRPLFPGSSEIDQLYKICSVLGTPTKQDWP 224


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 82.0 bits (203), Expect = 1e-20
 Identities = 28/52 (53%), Positives = 35/52 (67%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGT 64
           APELL G   YG  +D+WA+GCI+ ELL   P  PG+SD+DQL  I + LG 
Sbjct: 169 APELLVGDTNYGKPVDVWAIGCIMAELLDGEPLFPGDSDIDQLYLIQKCLGP 220


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 5.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK5 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK5
           is unusual in that it is regulated by non-cyclin
           proteins, p35 and p39. It is highly expressed in the
           nervous system and is critical in normal neural
           development and function. It plays a role in neuronal
           migration and differentiation, and is also important in
           synaptic plasticity and learning. CDK5 also participates
           in protecting against cell death and promoting
           angiogenesis. Impaired CDK5 activity is implicated in
           Alzheimer's disease, amyotrophic lateral sclerosis,
           Parkinson's disease, Huntington's disease and acute
           neuronal injury.
          Length = 284

 Score = 81.7 bits (202), Expect = 2e-20
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 1/62 (1%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKA-PFLPGESDLDQLTRIFQTLGTPSEDT 69
           +  P++LFGA++Y   IDMW+ GCI  EL     P  PG    DQL RIF+ LGTP+E++
Sbjct: 165 YRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEES 224

Query: 70  WP 71
           WP
Sbjct: 225 WP 226


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 4 and 6-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) and CDK6-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK4/6-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDK4 and CDK6
           partner with D-type cyclins to regulate the early G1
           phase of the cell cycle. They are the first kinase
           activated by mitogenic signals to release cells from the
           G0 arrested state. CDK4 and CDK6 are both expressed
           ubiquitously, associate with all three D cyclins (D1, D2
           and D3), and phosphorylate the retinoblastoma (pRb)
           protein. They are also regulated by the INK4 family of
           inhibitors which associate with either the CDK alone or
           the CDK/cyclin complex. CDK4 and CDK6 show differences
           in subcellular localization, sensitivity to some
           inhibitors, timing in activation, tumor selectivity, and
           possibly substrate profiles. Although CDK4 and CDK6 seem
           to show some redundancy, they also have discrete,
           nonoverlapping functions. CDK6 plays an important role
           in cell differentiation.
          Length = 287

 Score = 81.9 bits (203), Expect = 2e-20
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           APE+L  +  Y   +DMW+VGCI  EL  + P   G S+ DQL +IF  +G PSE+ WP
Sbjct: 174 APEVLLQSS-YATPVDMWSVGCIFAELFRRRPLFRGTSEADQLDKIFDVIGLPSEEEWP 231


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 8-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK8-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK8, CDC2L6, and similar proteins. CDK8
           functions as a negative or positive regulator of
           transcription, depending on the scenario. Together with
           its regulator, cyclin C, it reversibly associates with
           the multi-subunit core Mediator complex, a cofactor that
           is involved in regulating RNA polymerase II (RNAP
           II)-dependent transcription. CDC2L6 also associates with
           Mediator in complexes lacking CDK8. In VP16-dependent
           transcriptional activation, CDK8 and CDC2L6 exerts
           opposing effects by positive and negative regulation,
           respectively, in similar conditions.
          Length = 316

 Score = 80.4 bits (199), Expect = 8e-20
 Identities = 34/69 (49%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD---------LDQLTRIFQTLG 63
           APELL GAR Y   ID+WA+GCI  ELL   P   G             DQL RIF+ LG
Sbjct: 183 APELLLGARHYTKAIDIWAIGCIFAELLTLEPIFKGREAKIKKSNPFQRDQLERIFEVLG 242

Query: 64  TPSEDTWPT 72
           TP+E  WP 
Sbjct: 243 TPTEKDWPD 251


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase 15.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK15 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. Human MAPK15 is also called
           Extracellular signal Regulated Kinase 8 (ERK8) while the
           rat protein is called ERK7. ERK7 and ERK8 display both
           similar and different biochemical properties. They
           autophosphorylate and activate themselves and do not
           require upstream activating kinases. ERK7 is
           constitutively active and is not affected by
           extracellular stimuli whereas ERK8 shows low basal
           activity and is activated by DNA-damaging agents. ERK7
           and ERK8 also have different substrate profiles. Genome
           analysis shows that they are orthologs with similar gene
           structures. ERK7 and ERK 8 may be involved in the
           signaling of some nuclear receptor transcription
           factors. ERK7 regulates hormone-dependent degradation of
           estrogen receptor alpha while ERK8 down-regulates the
           transcriptional co-activation androgen and
           glucocorticoid receptors.
          Length = 337

 Score = 79.9 bits (198), Expect = 1e-19
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APE+L G+  Y  G+DMW+VGCI+ E+LL  P  PG S L+QL +I + +G PS +
Sbjct: 180 APEILLGSTRYTKGVDMWSVGCILGEMLLGKPLFPGTSTLNQLEKIIEVIGPPSAE 235


>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), PCTAIRE-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The PCTAIRE-like subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily share sequence similarity with
           Cyclin-Dependent Kinases (CDKs), which belong to a large
           family of STKs that are regulated by their cognate
           cyclins. Together, CDKs and cyclins are involved in the
           control of cell-cycle progression, transcription, and
           neuronal function. The association of PCTAIRE-like
           proteins with cyclins has not been widely studied,
           although PFTAIRE-1 has been shown to function as a CDK
           which is regulated by cyclin D3 as well as the
           membrane-associated cyclin Y. PCTAIRE-like proteins show
           unusual expression patterns with high levels in
           post-mitotic tissues, suggesting that they may be
           involved in regulating post-mitotic cellular events.
          Length = 291

 Score = 79.3 bits (196), Expect = 1e-19
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 14  PELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD-LDQLTRIFQTLGTPSEDTWPT 72
           P++L G+  Y   +DMW VGCI  E+    P  PG +D  DQL +IF+ LGTP+E+TWP 
Sbjct: 172 PDVLLGSTEYSTSLDMWGVGCIFYEMATGRPLFPGSTDVEDQLHKIFRVLGTPTEETWPG 231


>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional.
          Length = 440

 Score = 80.1 bits (197), Expect = 2e-19
 Identities = 31/58 (53%), Positives = 41/58 (70%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           + APEL+ GA  Y   ID+W++GCII E++L  P   G+S +DQL RI Q LGTP+ED
Sbjct: 236 YRAPELMLGATNYTTHIDLWSLGCIIAEMILGYPIFSGQSSVDQLVRIIQVLGTPTED 293


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
           Serine/Threonine Kinases (STKs), Pho85 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Pho85 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Pho85 is a
           multifunctional Cyclin-Dependent protein Kinase (CDK) in
           yeast. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. Pho85 is regulated
           by 10 different cyclins (Pcls) and plays a role in G1
           progression, cell polarity, phosphate and glycogen
           metabolism, gene expression, and in signaling changes in
           the environment. It is not essential for yeast viability
           and is the functional homolog of mammalian CDK5, which
           plays a role in central nervous system development.
          Length = 284

 Score = 77.9 bits (192), Expect = 4e-19
 Identities = 29/61 (47%), Positives = 44/61 (72%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + AP++L G+R Y   ID+W+VGCI+ E++   P  PG ++ DQL +IF+ +GTP+E TW
Sbjct: 166 YRAPDVLLGSRTYSTSIDIWSVGCIMAEMITGRPLFPGTNNEDQLLKIFRIMGTPTESTW 225

Query: 71  P 71
           P
Sbjct: 226 P 226


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
           Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MPK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of the MAPKs MPK1 from Saccharomyces
           cerevisiae, Pmk1 from Schizosaccharomyces pombe, and
           similar proteins. MAPKs are important mediators of
           cellular responses to extracellular signals. MPK1 (also
           called Slt2) and Pmk1 (also called Spm1) are
           stress-activated MAPKs that regulate the cell wall
           integrity (CWI) pathway, and are therefore important in
           the maintainance of cell shape, cell wall construction,
           morphogenesis, and ion homeostasis. MPK1 is activated in
           response to cell wall stress including heat stimulation,
           osmotic shock, UV irradiation, and any agents that
           interfere with cell wall biogenesis such as chitin
           antagonists, caffeine, or zymolase. MPK1 is regulated by
           the MAP2Ks Mkk1/2, which are regulated by the MAP3K
           Bck1. Pmk1 is also activated by multiple stresses
           including elevated temperatures, hyper- or hypotonic
           stress, glucose deprivation, exposure to cell-wall
           damaging compounds, and oxidative stress. It is
           regulated by the MAP2K Pek1, which is regulated by the
           MAP3K Mkh1.
          Length = 332

 Score = 74.7 bits (184), Expect = 9e-18
 Identities = 30/71 (42%), Positives = 42/71 (59%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPT 72
           APE++   + Y   ID+W+VGCI+ ELL + P   G+  +DQL +I Q LGTP E+T   
Sbjct: 177 APEIMLSFQSYTKAIDVWSVGCILAELLGRKPVFKGKDYVDQLNQILQVLGTPDEETLSR 236

Query: 73  AGVKGLFSLIR 83
            G     + IR
Sbjct: 237 IGSPKAQNYIR 247


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
           signal-Regulated Kinase 1 and 2-like Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), Extracellular
           signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. This
           ERK1/2-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           the mitogen-activated protein kinases (MAPKs) ERK1,
           ERK2, baker's yeast Fus3, and similar proteins. MAPK
           pathways are important mediators of cellular responses
           to extracellular signals. ERK1/2 activation is
           preferentially by mitogenic factors, differentiation
           stimuli, and cytokines, through a kinase cascade
           involving the MAPK kinases MEK1/2 and a MAPK kinase
           kinase from the Raf family. ERK1/2 have numerous
           substrates, many of which are nuclear and participate in
           transcriptional regulation of many cellular processes.
           They regulate cell growth, cell proliferation, and cell
           cycle progression from G1 to S phase. Although the
           distinct roles of ERK1 and ERK2 have not been fully
           determined, it is known that ERK2 can maintain most
           functions in the absence of ERK1, and that the deletion
           of ERK2 is embryonically lethal. The MAPK, Fus3,
           regulates yeast mating processes including
           mating-specific gene expression, G1 arrest, mating
           projection, and cell fusion.
          Length = 336

 Score = 71.6 bits (176), Expect = 2e-16
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APE++  ++ Y   ID+W+VGCI+ E+L   P  PG+  L QL  I   LGTPS++
Sbjct: 177 APEIMLNSKGYTKAIDIWSVGCILAEMLSNRPLFPGKDYLHQLNLILGVLGTPSQE 232


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 1 (CDKL1) and CDKL4 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL1 and CDKL4
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL1, also called
           p42 KKIALRE, is a glial protein that is upregulated in
           gliosis. It is present in neuroblastoma and A431 human
           carcinoma cells, and may be implicated in neoplastic
           transformation. The function of CDKL4 is unknown.
          Length = 286

 Score = 71.2 bits (175), Expect = 2e-16
 Identities = 28/51 (54%), Positives = 35/51 (68%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLG 63
           APELL G   YG  +D+WA+GC+  ELL   P  PG+SD+DQL  I +TLG
Sbjct: 168 APELLVGDTQYGPPVDVWAIGCVFAELLTGQPLWPGKSDVDQLYLIRKTLG 218


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 2 (CDKL2) and CDKL3 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL2 and CDKL3
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL2, also called
           p56 KKIAMRE, is expressed in testis, kidney, lung, and
           brain. It functions mainly in mature neurons and plays
           an important role in learning and memory. Inactivation
           of CDKL3, also called NKIAMRE (NKIATRE in rat), by
           translocation is associated with mild mental
           retardation. It has been reported that CDKL3 is lost in
           leukemic cells having a chromosome arm 5q deletion, and
           may contribute to the transformed phenotype.
          Length = 286

 Score = 70.9 bits (174), Expect = 2e-16
 Identities = 27/54 (50%), Positives = 36/54 (66%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGT 64
           + APELL G   YG  +D+WAVGC++ E+L   P  PG+SD+DQL  I + LG 
Sbjct: 166 YRAPELLVGDTKYGRAVDIWAVGCLVTEMLTGEPLFPGDSDIDQLYHIIKCLGN 219


>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-2 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-2 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-2 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-2 is
           specifically expressed in neurons in the central nervous
           system, mainly in terminally differentiated neurons. It
           associates with Trap (Tudor repeat associator with
           PCTAIRE-2) and could play a role in regulating
           mitochondrial function in neurons.
          Length = 309

 Score = 70.8 bits (173), Expect = 2e-16
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +  P++L G+  Y   IDMW VGCI  E+    P  PG +  D+L  IF+ LGTP+E+TW
Sbjct: 170 YRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPTEETW 229

Query: 71  P 71
           P
Sbjct: 230 P 230


>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PFTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PFTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PFTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PFTAIRE-1 is
           widely expressed except in the spleen and thymus. It is
           highly expressed in the brain, heart, pancreas, testis,
           and ovary, and is localized in the cytoplasm. It is
           regulated by cyclin D3 and is inhibited by the p21 cell
           cycle inhibitor. It has also been shown to interact with
           the membrane-associated cyclin Y, which recruits the
           protein to the plasma membrane.
          Length = 303

 Score = 70.5 bits (172), Expect = 3e-16
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDL-DQLTRIFQTLGTPSEDT 69
           +  P++L G+  Y   +DMW VGCI  E++      PG  D+ DQL RIF  LGTP+EDT
Sbjct: 169 YRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDT 228

Query: 70  WPTAGVKGL 78
           WP  GV  L
Sbjct: 229 WP--GVHSL 235


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 69.6 bits (171), Expect = 4e-16
 Identities = 28/62 (45%), Positives = 37/62 (59%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +MAPE+L G   YG  +D+W++G I+ ELL   P   GE+ LDQL  I + LG P E   
Sbjct: 164 YMAPEVLLGGNGYGPKVDVWSLGVILYELLTGKPPFSGENILDQLQLIRRILGPPLEFDE 223

Query: 71  PT 72
           P 
Sbjct: 224 PK 225


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-1 is
           expressed ubiquitously and is localized in the
           cytoplasm. Its kinase activity is cell cycle dependent
           and peaks at the S and G2 phases. PCTAIRE-1 is highly
           expressed in the brain and may play a role in regulating
           neurite outgrowth. It can also associate with Trap
           (Tudor repeat associator with PCTAIRE-2), a
           physiological partner of PCTAIRE-2; with p11, a small
           dimeric protein with similarity to S100; and with 14-3-3
           proteins, mediators of phosphorylation-dependent
           interactions in many different proteins.
          Length = 301

 Score = 70.0 bits (171), Expect = 4e-16
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +  P++L G+  Y   IDMW VGCI  E+    P  PG +  +QL  IF+ LGTP+E+TW
Sbjct: 170 YRPPDILLGSTDYSTQIDMWGVGCIFYEMSTGRPLFPGSTVEEQLHFIFRILGTPTEETW 229

Query: 71  P 71
           P
Sbjct: 230 P 230


>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-3 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-3 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-3 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-3 shows a
           restricted pattern of expression and is present in
           brain, kidney, and intestine. It is elevated in
           Alzheimer's disease (AD) and has been shown to associate
           with paired helical filaments (PHFs) and stimulate Tau
           phosphorylation. As AD progresses, phosphorylated Tau
           aggregates and forms PHFs, which leads to the formation
           of neurofibrillary tangles (NFTs). In human glioma
           cells, PCTAIRE-3 induces cell cycle arrest and cell
           death.
          Length = 288

 Score = 69.3 bits (169), Expect = 8e-16
 Identities = 27/61 (44%), Positives = 39/61 (63%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +  P++L G+  Y   IDMW VGCI+ E+    P  PG +  ++L  IF+ LGTP+E+TW
Sbjct: 169 YRPPDVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGSTVKEELHLIFRLLGTPTEETW 228

Query: 71  P 71
           P
Sbjct: 229 P 229


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
           Kinase,  Extracellular signal-Regulated Kinase 5.
           Serine/Threonine Kinases (STKs), Extracellular
           signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ERK5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. ERK5, also called Big MAPK1
           (BMK1) or MAPK7, has a unique C-terminal extension,
           making it approximately twice as big as other MAPKs.
           This extension contains transcriptional activation
           capability which is inhibited by the N-terminal half.
           ERK5 is activated in response to growth factors and
           stress by a cascade that leads to its phosphorylation by
           the MAP2K MEK5, which in turn is regulated by the MAP3Ks
           MEKK2 and MEKK3. Activated ERK5 phosphorylates its
           targets including myocyte enhancer factor 2 (MEF2),
           Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
           cell proliferation during the G1/S phase transition.
           Studies on knockout mice revealed that ERK5 is essential
           for cardiovascular development and plays an important
           role in angiogenesis. It is also critical for neural
           differentiation and survival. The ERK5 pathway has been
           implicated in the pathogenesis of many diseases
           including cancer, cardiac hypertrophy, and
           atherosclerosis.
          Length = 334

 Score = 69.3 bits (170), Expect = 1e-15
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APELL     Y   IDMW+VGCI  E+L +    PG++ + QL  I   LG+PSE+
Sbjct: 179 APELLLSLPEYTTAIDMWSVGCIFAEMLGRRQLFPGKNYVHQLKLILSVLGSPSEE 234


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TEY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TEY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TEY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. There are two subtypes
           of plant MAPKs based on the conserved phosphorylation
           motif present in the activation loop, TEY and TDY. This
           subfamily represents the TEY subtype and is further
           subdivided into three groups (A, B, and C). Group A is
           represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
           (NtNTF4), among others. They are mostly involved in
           environmental and hormonal responses. AtMPK3 and  AtMPK6
           are also key regulators for stomatal development and
           patterning. Group B is represented by AtMPK4, AtMPK13,
           and NtNTF6, among others. They may be involved in both
           cell division and environmental stress response. AtMPK4
           also participates in regulating innate immunity. Group C
           is represented by AtMPK1, AtMPK2, NtNTF3, Oryza sativa
           MAPK4 (OsMAPK4), among others. They may also be involved
           in stress responses. AtMPK1 and AtMPK2 are activated
           following mechanical injury and in the presence of
           stress chemicals such as jasmonic acid, hydrogen
           peroxide and abscisic acid. OsMAPK4 is also called
           OsMSRMK3 for Multiple Stress-Responsive MAPK3.
          Length = 337

 Score = 68.2 bits (167), Expect = 3e-15
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS 66
           V + + APELL     Y   ID+W+VGCI  ELL + P  PG+  + QL  I + LG+PS
Sbjct: 170 VTRWYRAPELLLNCSEYTTAIDVWSVGCIFAELLGRKPLFPGKDYVHQLKLITELLGSPS 229

Query: 67  ED 68
           E+
Sbjct: 230 EE 231


>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 6.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 6 (CDK6) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK6
           is regulated by D-type cyclins and INK4 inhibitors. It
           is active towards the retinoblastoma (pRb) protein,
           implicating it to function in regulating the early G1
           phase of the cell cycle. It is expressed ubiquitously
           and is localized in the cytoplasm. It is also present in
           the ruffling edge of spreading fibroblasts and may play
           a role in cell spreading. It binds to the p21 inhibitor
           without any effect on its own activity and it is
           overexpressed in squamous cell carcinomas and
           neuroblastomas. CDK6 has also been shown to inhibit cell
           differentiation in many cell types.
          Length = 290

 Score = 66.6 bits (162), Expect = 9e-15
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L  +  Y   +D+W+VGCI  E+  + P   G SD+DQL +I   +G P E+ W
Sbjct: 175 YRAPEVLLQSS-YATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDW 233

Query: 71  P 71
           P
Sbjct: 234 P 234


>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK4 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK4
           partners with all three D-type cyclins (D1, D2, and D3)
           and is also regulated by INK4 inhibitors. It is active
           towards the retinoblastoma (pRb) protein and plays a
           role in regulating the early G1 phase of the cell cycle.
           It is expressed ubiquitously and is localized in the
           nucleus. CDK4 also shows kinase activity towards Smad3,
           a signal transducer of transforming growth factor
           (TGF)-beta signaling which modulates transcription and
           plays a role in cell proliferation and apoptosis. CDK4
           is inhibited by the p21 inhibitor and is specifically
           mutated in human melanoma.
          Length = 288

 Score = 66.1 bits (161), Expect = 1e-14
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           + APE+L  +  Y   +DMW+VGCI  E+  + P   G S+ DQL +IF  +G P ED W
Sbjct: 173 YRAPEVLLQS-TYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDW 231

Query: 71  PT 72
           P 
Sbjct: 232 PR 233


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase,
           p38 Mitogen-Activated Protein Kinase.  Serine/Threonine
           Kinases (STKs), p38 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The p38 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. p38 kinases are
           mitogen-activated protein kinases (MAPKs), serving as
           important mediators of cellular responses to
           extracellular signals. They function in the regulation
           of the cell cycle, cell development, cell
           differentiation, senescence, tumorigenesis, apoptosis,
           pain development and pain progression, and immune
           responses. p38 kinases are activated by the MAPK kinases
           MKK3 and MKK6, which in turn are activated by upstream
           MAPK kinase kinases including TAK1, ASK1, and MLK3, in
           response to cellular stresses or inflammatory cytokines.
           p38 substrates include other protein kinases and factors
           that regulate transcription, nuclear export, mRNA
           stability and translation. p38 kinases are drug targets
           for the inflammatory diseases psoriasis, rheumatoid
           arthritis, and chronic pulmonary disease. Vertebrates
           contain four isoforms of p38, named alpha, beta, gamma,
           and delta, which show varying substrate specificity and
           expression patterns. p38alpha and p38beta are
           ubiquitously expressed, p38gamma is predominantly found
           in skeletal muscle, and p38delta is found in the heart,
           lung, testis, pancreas, and small intestine.
          Length = 343

 Score = 66.5 bits (163), Expect = 1e-14
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APE++     Y   +D+W+VGCI+ ELL      PG   +DQL RI   +GTP E+
Sbjct: 183 APEIMLNWMHYNQTVDIWSVGCIMAELLTGKTLFPGSDHIDQLKRIMNLVGTPDEE 238


>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 9.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK9 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK9
           together with a cyclin partner (cyclin T1, T2a, T2b, or
           K) is the main component of distinct positive
           transcription elongation factors (P-TEFb), which
           function as Ser2 C-terminal domain kinases of RNA
           polymerase II. P-TEFb participates in multiple steps of
           gene expression including transcription elongation, mRNA
           synthesis, processing, export, and translation. It also
           plays a role in mediating cytokine induced transcription
           networks such as IL6-induced STAT3 signaling. In
           addition, the CDK9/cyclin T2a complex promotes muscle
           differentiation and enhances the function of some
           myogenic regulatory factors.
          Length = 310

 Score = 65.9 bits (161), Expect = 2e-14
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
            PELL G R YG  IDMW  GCI+ E+  ++P + G ++  QLT I Q  G+ + + WP
Sbjct: 191 PPELLLGERDYGPPIDMWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWP 249


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
           MAPK/MAK/MRK Overlapping Kinase.  Serine/Threonine
           Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MOK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MOK, also called Renal tumor antigen 1
           (RAGE-1), is widely expressed and is enriched in testis,
           kidney, lung, and brain. It is expressed in
           approximately 50% of renal cell carcinomas (RCC) and is
           a potential target for immunotherapy. MOK is stabilized
           by its association with the HSP90 molecular chaperone.
           It is induced by the transcription factor Cdx2 and may
           be involved in regulating intestinal epithelial
           development and differentiation.
          Length = 282

 Score = 64.6 bits (158), Expect = 4e-14
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           APE L     YG  +D+WAVGC+  E+L   P  PG ++LDQ+ +I   LGTP  +
Sbjct: 166 APECLLTDGYYGPKMDIWAVGCVFFEILSLFPLFPGTNELDQIAKIHDVLGTPDAE 221


>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine
           Kinase, PFTAIRE-2 kinase.  Serine/Threonine Kinases
           (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PFTAIRE-2 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PFTAIRE-2 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PFTAIRE-2 is also
           referred to as ALS2CR7 (amyotrophic lateral sclerosis 2
           (juvenile) chromosome region candidate 7). It may be
           associated with amyotrophic lateral sclerosis 2 (ALS2),
           an autosomal recessive form of juvenile ALS. The
           function of PFTAIRE-2 is not yet known.
          Length = 291

 Score = 63.8 bits (155), Expect = 8e-14
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD-LDQLTRIFQTLGTPSEDT 69
           +  P++L GA  Y   +D+W  GCI  E+L   P  PG SD  +QL +I+  LG P+EDT
Sbjct: 169 YRPPDVLLGATDYSSALDIWGAGCIFIEMLQGQPAFPGVSDVFEQLEKIWTVLGVPTEDT 228

Query: 70  WP 71
           WP
Sbjct: 229 WP 230


>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 8.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 8 (CDK8) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK8 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK8
           can act as a negative or positive regulator of
           transcription, depending on the scenario. Together with
           its regulator, cyclin C, it reversibly associates with
           the multi-subunit core Mediator complex, a cofactor that
           is involved in regulating RNA polymerase II (RNAP
           II)-dependent transcription. CDK8 phosphorylates cyclin
           H, a subunit of the general transcription factor TFIIH,
           which results in the inhibition of TFIIH-dependent
           phosphorylation of the C-terminal domain (CTD) of RNAP
           II, facilitating the inhibition of transcription. It has
           also been shown to promote transcription by a mechanism
           that is likely to involve RNAP II phosphorylation. CDK8
           also functions as a stimulus-specific positive
           coregulator of p53 transcriptional responses.
          Length = 317

 Score = 62.4 bits (151), Expect = 3e-13
 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 9/69 (13%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP-FLPGESDL--------DQLTRIFQT 61
           + APELL GAR Y   ID+WA+GCI  ELL   P F   + D+        DQL RIF  
Sbjct: 181 YRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNV 240

Query: 62  LGTPSEDTW 70
           +G P++  W
Sbjct: 241 MGFPADKDW 249


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase Like 5.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 5 (CDKL5) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. Mutations in the gene encoding CDKL5,
           previously called STK9, are associated with early onset
           epilepsy and severe mental retardation [X-linked
           infantile spasm syndrome (ISSX) or West syndrome]. In
           addition, CDKL5 mutations also sometimes cause a
           phenotype similar to Rett syndrome (RTT), a progressive
           neurodevelopmental disorder. These pathogenic mutations
           are located in the N-terminal portion of the protein
           within the kinase domain.
          Length = 287

 Score = 61.9 bits (150), Expect = 4e-13
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGT-PSE 67
           + +PELL GA  YG  +DMW+VGCI+ EL    P  PGES++DQL  I + LG  P+E
Sbjct: 167 YRSPELLLGAP-YGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAE 223


>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 12.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 12 (CDK12) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK12 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK12 is also called Cdc2-related protein
           kinase 7 (CRK7) or Cdc2-related kinase
           arginine/serine-rich (CrkRS). It is a unique CDK that
           contains an arginine/serine-rich (RS) domain, which is
           predominantly found in splicing factors. CDK12 is widely
           expressed in tissues. It interacts with cyclins L1 and
           L2, and plays roles in regulating transcription and
           alternative splicing.
          Length = 302

 Score = 61.7 bits (150), Expect = 5e-13
 Identities = 25/58 (43%), Positives = 31/58 (53%)

Query: 14  PELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWP 71
           PELL G   YG  ID+W+ GCI+ EL  K P      +L QL  I +  G+P    WP
Sbjct: 186 PELLLGEERYGPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWP 243


>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase,
           Cell Division Cycle 2-like 6.  Serine/Threonine Kinases
           (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDC2L6 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDC2L6 is also called CDK8-like and was
           previously referred to as CDK11. However, this is a
           confusing nomenclature as CDC2L6 is distinct from
           CDC2L1, which is represented by the two protein products
           from its gene, called CDK11(p110) and CDK11(p58), as
           well as the caspase-processed CDK11(p46). CDK11(p110),
           CDK11(p58), and CDK11(p46)do not belong to this
           subfamily. CDC2L6 is an associated protein of Mediator,
           a multiprotein complex that provides a platform to
           connect transcriptional and chromatin regulators and
           cofactors, in order to activate and mediate RNA
           polymerase II transcription. CDC2L6 is localized mainly
           in the nucleus amd exerts an opposing effect to CDK8 in
           VP16-dependent transcriptional activation by being a
           negative regulator.
          Length = 317

 Score = 61.6 bits (149), Expect = 5e-13
 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 9/69 (13%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP-FLPGESDL--------DQLTRIFQT 61
           + APELL GAR Y   ID+WA+GCI  ELL   P F   + D+        DQL RIF  
Sbjct: 181 YRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSV 240

Query: 62  LGTPSEDTW 70
           +G P++  W
Sbjct: 241 MGFPADKDW 249


>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase,
           Nemo-Like Kinase.  Serine/Threonine Kinases (STKs),
           Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The NLK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mitogen-activated protein
           kinases (MAPKs) are important mediators of cellular
           responses to extracellular signals. NLK is an atypical
           MAPK that is not regulated by a MAPK kinase. It
           functions downstream of the MAPK kinase kinase Tak1,
           which also plays a role in activating the JNK and p38
           MAPKs. The Tak1/NLK pathways are regulated by Wnts, a
           family of secreted proteins that is critical in the
           control of asymmetric division and cell polarity. NLK
           can phosphorylate transcription factors from the TCF/LEF
           family, inhibiting their ability to activate the
           transcription of target genes. In prostate cancer cells,
           NLK is involved in regulating androgen receptor-mediated
           transcription and its expression is altered during
           cancer progression.
          Length = 372

 Score = 61.3 bits (149), Expect = 9e-13
 Identities = 26/60 (43%), Positives = 36/60 (60%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS 66
           V + + APE+L G+R Y   +D+W+VGCI  ELL +      +S + QL  I   LGTPS
Sbjct: 166 VTQYYRAPEILMGSRHYTSAVDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPS 225


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 60.2 bits (147), Expect = 1e-12
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 6/62 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIFQTLGTPSEDT 69
           +MAPE+L G + YG  +D+W++G I+ ELL  K PF       DQL  +F+ +G P    
Sbjct: 162 YMAPEVLLG-KGYGKAVDIWSLGVILYELLTGKPPF----PGDDQLLELFKKIGKPKPPF 216

Query: 70  WP 71
            P
Sbjct: 217 PP 218


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
           Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
           and Hog1.  Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Sty1/Hog1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of the MAPKs Sty1
           from Schizosaccharomyces pombe, Hog1 from Saccharomyces
           cerevisiae, and similar proteins. MAPKs are important
           mediators of cellular responses to extracellular
           signals. Sty1 and Hog1 are stress-activated MAPKs that
           partipate in transcriptional regulation in response to
           stress. Sty1 is activated in response to oxidative
           stress, osmotic stress, and UV radiation. Sty1 is
           regulated by the MAP2K Wis1, which is activated by the
           MAP3Ks Wis4 and Win1, which receive signals of the
           stress condition from membrane-spanning histidine
           kinases Mak1-3. Activated Sty1 stabilizes the Atf1
           transcription factor and induces transcription of
           Atf1-dependent genes of the core environmetal stress
           response (CESR). Hog1 is the key element in the high
           osmolarity glycerol (HOG) pathway and is activated upon
           hyperosmotic stress. Activated Hog1 accumulates in the
           nucleus and regulates stress-induced transcription. The
           HOG pathway is mediated by two transmembrane
           osmosensors, Sln1 and Sho1.
          Length = 328

 Score = 60.2 bits (146), Expect = 2e-12
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           + APE++   + Y V +D+W+ GCI  E+L   P  PG+  ++Q + I   LGTP +D
Sbjct: 171 YRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITDLLGTPPDD 228


>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the
           Serine/Threonine Kinase, p38beta Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38beta subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38beta subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38beta, also called MAPK11, is widely expressed
           in tissues and shows more similarity with p38alpha than
           with the other isoforms. Both are sensitive to
           pyridinylimidazoles and share some common substrates
           such as MAPK activated protein kinase 2 (MK2) and the
           transcription factors ATF2, c-Fos and, ELK-1. p38beta is
           involved in regulating the activation of the
           cyclooxygenase-2 promoter and the expression of
           TGFbeta-induced alpha-smooth muscle cell actin.
          Length = 343

 Score = 60.1 bits (145), Expect = 3e-12
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           + APE++     Y   +D+W+VGCI+ ELL      PG   +DQL RI + +GTPS +
Sbjct: 181 YRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPSPE 238


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
           Serine/Threonine Kinase, p38gamma Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38gamma subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38gamma subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38gamma, also called MAPK12, is predominantly
           expressed in skeletal muscle. Unlike p38alpha and
           p38beta, p38gamma is insensitive to pyridinylimidazoles.
           It displays an antagonizing function compared to
           p38alpha. p38gamma inhibits, while p38alpha stimulates,
           c-Jun phosphorylation and AP-1 mediated transcription.
           p38gamma also plays a role in the signaling between Ras
           and the estrogen receptor and has been implicated to
           increase cell invasion and breast cancer progression. In
           Xenopus, p38gamma is critical in the meiotic maturation
           of oocytes.
          Length = 343

 Score = 58.4 bits (141), Expect = 9e-12
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS 66
           V + + APE++     Y   +D+W+VGCI+ E+L   P   G   LDQL  I +  GTPS
Sbjct: 177 VTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMLTGKPLFKGHDHLDQLMEIMKVTGTPS 236

Query: 67  ED 68
           ++
Sbjct: 237 KE 238


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
           c-Jun N-terminal Kinase.  Serine/Threonine Kinases
           (STKs), c-Jun N-terminal kinase (JNK) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The JNK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. JNKs are
           mitogen-activated protein kinases (MAPKs) that are
           involved in many stress-activated responses including
           those during inflammation, neurodegeneration, apoptosis,
           and persistent pain sensitization, among others. They
           are also essential regulators of physiological and
           pathological processes and are involved in the
           pathogenesis of several diseases such as diabetes,
           atherosclerosis, stroke, Parkinson's and Alzheimer's.
           Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
           and Jnk3) that are alternatively spliced to produce at
           least 10 isoforms. JNKs are specifically activated by
           the MAPK kinases MKK4 and MKK7, which are in turn
           activated by upstream MAPK kinase kinases as a result of
           different stimuli including stresses such as ultraviolet
           (UV) irradiation, hyperosmolarity, heat shock, or
           cytokines. JNKs activate a large number of different
           substrates based on specific stimulus, cell type, and
           cellular condition, and may be implicated in seemingly
           contradictory functions.
          Length = 353

 Score = 56.3 bits (136), Expect = 6e-11
 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 7   VRKAFMAPELLFGARM-YGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           V + + APE++ G  M Y   +D+W+VGCI+ E++      PG   +DQ  +I + LGTP
Sbjct: 179 VTRYYRAPEVILG--MGYKENVDIWSVGCIMGEMIRGTVLFPGTDHIDQWNKIIEQLGTP 236

Query: 66  SED 68
           S++
Sbjct: 237 SDE 239


>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
           Serine/Threonine Kinase, p38alpha Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38alpha subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38alpha subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38alpha, also called MAPK14, is expressed in
           most tissues and is the major isoform involved in the
           immune and inflammatory response. It is the central p38
           MAPK involved in myogenesis. It plays a role in
           regulating cell cycle check-point transition and
           promoting cell differentiation. p38alpha also regulates
           cell proliferation and death through crosstalk with the
           JNK pathway. Its substrates include MAPK activated
           protein kinase 2 (MK2), MK5, and the transcription
           factors ATF2 and Mitf.
          Length = 345

 Score = 55.8 bits (134), Expect = 8e-11
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           + APE++     Y   +D+W+VGCI+ ELL      PG   +DQL  I + +GTP
Sbjct: 183 YRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTP 237


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TDY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TDY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TDY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. Oryza sativa contains
           at least 17 MAPKs. There are two subtypes of plant MAPKs
           based on the conserved phosphorylation motif present in
           the activation loop, TEY and TDY. Arabidopsis thaliana
           contains more TEY-type MAPKs than TDY-type, whereas the
           reverse is true for Oryza sativa. This subfamily
           represents the TDY subtype and is composed of Group D
           plant MAPKs including Arabidopsis thaliana MPK18
           (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
           (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
           Zea mays MPK6, and the Medicago sativa TDY1 gene
           product. OsBWMK1 enhances resistance to pathogenic
           infections. It mediates stress-activated defense
           responses by activating a transcription factor that
           affects the expression of stress-related genes. AtMPK18
           is involved in microtubule-related functions.
          Length = 338

 Score = 55.6 bits (134), Expect = 8e-11
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 11  FMAPELL--FGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSED 68
           + APEL   F ++ Y   ID+W++GCI  E+L   P  PG++ + QL  I   LGTPS +
Sbjct: 172 YRAPELCGSFFSK-YTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLITDLLGTPSPE 230

Query: 69  T 69
           T
Sbjct: 231 T 231


>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
           Kinases, Mitogen-Activated Protein Kinases 4 and 6.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK4/6 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. MAPK4 is also called ERK4 or
           p63MAPK, while MAPK6 is also called ERK3 or p97MAPK.
           MAPK4 and MAPK6 are atypical MAPKs that are not
           regulated by MAP2Ks. MAPK6 is expressed ubiquitously
           with highest amounts in brain and skeletal muscle. It
           may be involved in the control of cell differentiation
           by negatively regulating cell cycle progression in
           certain conditions. It may also play a role in
           glucose-induced insulin secretion. MAPK6 and MAPK4
           cooperate to regulate the activity of MAPK-activated
           protein kinase 5 (MK5), leading to its relocation to the
           cytoplasm and exclusion from the nucleus. The MAPK6/MK5
           and MAPK4/MK5 pathways may play critical roles in
           embryonic and post-natal development.
          Length = 342

 Score = 53.6 bits (129), Expect = 4e-10
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           V K + +P LL     Y   IDMWA GCI  E+L   P   G  +L+Q+  I +++
Sbjct: 180 VTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKPLFAGAHELEQMQLILESV 235


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates. JNK1
           specifically binds with JAMP (JNK1-associated membrane
           protein), which regulates the duration of JNK1 activity
           in response to stimuli. Specific JNK1 substrates include
           Itch and SG10, which are implicated in Th2 responses and
           airway inflammation, and microtubule dynamics and
           axodendritic length, respectively. Mice deficient in
           Jnk1 are protected against arthritis, obesity, type 2
           diabetes, cardiac cell death, and non-alcoholic liver
           disease, suggesting that JNK1 may play roles in the
           pathogenesis of these diseases.
          Length = 364

 Score = 51.2 bits (122), Expect = 3e-09
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           V + + APE++ G   Y   +D+W+VGCI+ E++      PG   +DQ  ++ + LGTP
Sbjct: 187 VTRYYRAPEVILGMG-YKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTP 244


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates.  JNK2
           is specifically translocated to the mitochondria during
           dopaminergic cell death. Specific substrates include the
           microtubule-associated proteins DCX and Tau, as well as
           TIF-IA which is involved in ribosomal RNA synthesis
           regulation. Mice deficient in Jnk2 show protection
           against arthritis, type 1 diabetes, atherosclerosis,
           abdominal aortic aneurysm, cardiac cell death,
           TNF-induced liver damage, and tumor growth, indicating
           that JNK2 may play roles in the pathogenesis of these
           diseases.
          Length = 359

 Score = 51.2 bits (122), Expect = 4e-09
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS 66
           V + + APE++ G   Y   +D+W+VGCI+ EL+  +    G   +DQ  ++ + LGTPS
Sbjct: 184 VTRYYRAPEVILGMG-YKENVDIWSVGCIMGELVKGSVIFQGTDHIDQWNKVIEQLGTPS 242


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
           Serine/Threonine Kinase, p38delta Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38delta subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38delta subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38delta, also called MAPK13, is found in
           skeletal muscle, heart, lung, testis, pancreas, and
           small intestine. It regulates microtubule function by
           phosphorylating Tau. It activates the c-jun promoter and
           plays a role in G2 cell cycle arrest. It also controls
           the degration of c-Myb, which is associated with myeloid
           leukemia and poor prognosis in colorectal cancer.
           p38delta is the main isoform involved in regulating the
           differentiation and apoptosis of keratinocytes.
          Length = 342

 Score = 50.7 bits (121), Expect = 4e-09
 Identities = 22/62 (35%), Positives = 35/62 (56%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS 66
           V + + APE++     Y   +D+W+VGCI+ E+L       G+  LDQLT+I +  G P 
Sbjct: 176 VTRWYRAPEVILNWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPG 235

Query: 67  ED 68
            +
Sbjct: 236 PE 237


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is
           expressed primarily in the brain, and to a lesser extent
           in the heart and testis. Mice deficient in Jnk3 are
           protected against kainic acid-induced seizures, stroke,
           sciatic axotomy neural death, and neuronal death due to
           NGF deprivation, oxidative stress, or exposure to
           beta-amyloid peptide. This suggests that JNK3 may play
           roles in the pathogenesis of these diseases.
          Length = 355

 Score = 50.5 bits (120), Expect = 6e-09
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 7   VRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           V + + APE++ G   Y   +D+W+VGCI+ E++      PG   +DQ  ++ + LGTP
Sbjct: 180 VTRYYRAPEVILGMG-YKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTP 237


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 46.3 bits (108), Expect = 2e-07
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 10/84 (11%)

Query: 10  AFMAPELLFG--ARMYGVGIDMWAVGCIICELLL-KAPF--LPGESDLDQLTRIFQTLGT 64
            +MAPE+L G          D+W++G  + ELL    PF      S   Q  +I   L T
Sbjct: 173 GYMAPEVLLGLSLAYASSSSDIWSLGITLYELLTGLPPFEGEKNSSATSQTLKIILELPT 232

Query: 65  PS-----EDTWPTAGVKGLFSLIR 83
           PS       + P    K    L++
Sbjct: 233 PSLASPLSPSNPELISKAASDLLK 256


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 42.3 bits (100), Expect = 4e-06
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 9   KAFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDL--DQLTRIFQTLGTP 65
             +MAPE+L   + Y V +D W++G    E L  K P+  G S    DQ+    +T    
Sbjct: 163 PGYMAPEVLC-RQGYSVAVDWWSLGVTAYECLRGKRPY-RGHSRTIRDQIRAKQETADVL 220

Query: 66  SEDTWPTAGVKGLFSLI 82
              TW T  +  +  L+
Sbjct: 221 YPATWSTEAIDAINKLL 237


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 42.2 bits (100), Expect = 4e-06
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICEL 39
           A+MAPE+L G   Y    D+W++G I+ EL
Sbjct: 158 AYMAPEVLLGKGYYSEKSDIWSLGVILYEL 187


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 42.2 bits (99), Expect = 5e-06
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQ---TLGTPS 66
           AFMAPE+L G + YG   D+W+VGC+I E+    P    E   + L  IF+       PS
Sbjct: 173 AFMAPEVLRGEQ-YGRSCDVWSVGCVIIEMATAKPPWNAEKHSNHLALIFKIASATTAPS 231


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 39.4 bits (93), Expect = 4e-05
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +++PEL      Y    D+W++GC++ EL  LK PF
Sbjct: 169 YLSPELCQNKP-YNYKSDIWSLGCVLYELCTLKHPF 203


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 9.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek9 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek9, also called
           Nercc1, is primarily a cytoplasmic protein but can also
           localize in the nucleus. It is involved in modulating
           chromosome alignment and splitting during mitosis. It
           interacts with the gamma-tubulin ring complex and the
           Ran GTPase, and is implicated in microtubule
           organization. Nek9 associates with FACT (FAcilitates
           Chromatin Transcription) and modulates interphase
           progression. It also interacts with Nek6, and Nek7,
           during mitosis, resulting in their activation.
          Length = 256

 Score = 39.3 bits (92), Expect = 5e-05
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPFLPGESDLDQLTRIFQTLGTPSEDT 69
           +M+PEL  G + Y    D+WA+GC++ ELL LK  F    + L+ + +I Q   TP    
Sbjct: 167 YMSPELCQGVK-YNFKSDIWALGCVLYELLTLKRTF-DATNPLNLVVKIVQGNYTPVVSV 224

Query: 70  WPTAGVKGLFSLIRA 84
           +       L SL+ +
Sbjct: 225 YS----SELISLVHS 235


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 39.0 bits (92), Expect = 5e-05
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 12  MAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +APE+L G   YG  +D W++G ++ E+L  K PF
Sbjct: 160 LAPEVLLGKG-YGKAVDWWSLGVLLYEMLTGKPPF 193


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 39.1 bits (92), Expect = 6e-05
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQL 55
           ++APE++   + Y   +D W++G ++ ELL  + PF  GE D D +
Sbjct: 158 YVAPEIILN-KGYDFSVDYWSLGILLYELLTGRPPF--GEDDEDPM 200


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 38.4 bits (90), Expect = 1e-04
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLT--RIF---QTLGTP 65
           ++APE+L G   YG+  D W++G I+ E+L   P  P  SD  Q T  +I    ++L  P
Sbjct: 196 YIAPEVLRGTP-YGLECDWWSLGVILYEMLYGFP--PFYSDTLQETYNKIINWKESLRFP 252

Query: 66  SEDTWP 71
            +    
Sbjct: 253 PDPPVS 258


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 37.9 bits (89), Expect = 2e-04
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +++PELL      G   D+WA+GCII ++L  K PF
Sbjct: 188 YVSPELLNEKPA-GKSSDLWALGCIIYQMLTGKPPF 222


>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled
           Receptor Kinase 4-like Protein Serine/Threonine Kinases.
            Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, GRK4-like group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. Members of the
           GRK4-like group include GRK4, GRK5, GRK6, and similar
           GRKs. GRKs in this group contain an N-terminal RGS
           homology (RH) domain and a catalytic domain, but lack a
           G protein betagamma-subunit binding domain. They are
           localized to the plasma membrane through
           post-translational lipid modification or direct binding
           to PIP2.
          Length = 285

 Score = 37.5 bits (87), Expect = 2e-04
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +MAPE++   R Y    D W +GC+I E++  K+PF
Sbjct: 167 YMAPEVVKNER-YTFSPDWWGLGCLIYEMIEGKSPF 201


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 37.6 bits (88), Expect = 2e-04
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +M+PE L     Y    D+W++GC+I EL  L  PF
Sbjct: 176 YMSPEQLNHMS-YDEKSDIWSLGCLIYELCALSPPF 210


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 37.5 bits (88), Expect = 2e-04
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
            +MAPE++ G   YG   D+W++GC + E+   K P+
Sbjct: 168 YWMAPEVIRGEE-YGRAADIWSLGCTVIEMATGKPPW 203


>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase N.  Serine/Threonine Kinases
           (STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKN subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKN has a
           C-terminal catalytic domain that is highly homologous to
           PKCs. Its unique N-terminal regulatory region contains
           antiparallel coiled-coil (ACC) domains. In mammals,
           there are three PKN isoforms from different genes
           (designated PKN-alpha, beta, and gamma), which show
           different enzymatic properties, tissue distribution, and
           varied functions. PKN can be activated by the small
           GTPase Rho, and by fatty acids such as arachidonic and
           linoleic acids. It is involved in many biological
           processes including cytokeletal regulation, cell
           adhesion, vesicle transport, glucose transport,
           regulation of meiotic maturation and embryonic cell
           cycles, signaling to the nucleus, and tumorigenesis.
          Length = 324

 Score = 37.4 bits (87), Expect = 2e-04
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGE 49
           F+APE+L     Y   +D W +G +I E+L+ ++PF PG+
Sbjct: 167 FLAPEVLTETS-YTRAVDWWGLGVLIYEMLVGESPF-PGD 204


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 37.2 bits (87), Expect = 2e-04
 Identities = 12/34 (35%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APE++ G + +   +D W++GCI+ E L+  P
Sbjct: 167 YIAPEVILG-QGHSKTVDWWSLGCILYEFLVGIP 199


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 36.7 bits (85), Expect = 3e-04
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIFQ 60
           +MAPE++     Y    D+W++GC++ E+L  K PF     D  QL  IF+
Sbjct: 178 WMAPEVV-KQTSYTRKADIWSLGCLVVEMLTGKHPF----PDCTQLQAIFK 223


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 36.3 bits (84), Expect = 5e-04
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 11  FMAPELL-FGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +MAPE++  G R YG   D+W++GC I E+   K PF
Sbjct: 175 YMAPEVIDKGPRGYGAPADIWSLGCTIVEMATGKPPF 211


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 36.6 bits (85), Expect = 5e-04
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGES 50
           +MAPE+L G + Y   +D W++GC++ E L   P   G +
Sbjct: 164 YMAPEVLRG-KGYDFTVDYWSLGCMLYEFLCGFPPFSGST 202


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 36.2 bits (84), Expect = 7e-04
 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 10  AFMAPELLFGARMYGVG--IDMWAVGCIICEL 39
           A+MAPE++ G +  G G   D+W++GC++ E+
Sbjct: 168 AYMAPEVITGGKGKGHGRAADIWSLGCVVLEM 199


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
           3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           MEKK3, MEKK2, and related proteins, all containing an
           N-terminal PB1 domain, which mediates oligomerization,
           and a C-terminal catalytic domain. MEKK2 and MEKK3 are
           mitogen-activated protein kinase (MAPK) kinase kinases
           (MAPKKKs or MKKKs or MAP3Ks), proteins that
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
           activates extracellular signal-regulated kinase 5
           (ERK5). The ERK5 cascade plays roles in promoting cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. MEKK3 plays an essential role in
           embryonic angiogenesis and early heart development.
           MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
           N-terminal kinase (JNK) and p38, through their
           respective MAPKKs.
          Length = 263

 Score = 35.9 bits (83), Expect = 7e-04
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIFQTLGTPSEDT 69
           +M+PE++ G   YG   D+W+VGC + E+L  K P+    ++ + +  IF+    P+   
Sbjct: 173 WMSPEVISG-EGYGRKADVWSVGCTVVEMLTEKPPW----AEFEAMAAIFKIATQPTNPQ 227

Query: 70  WP 71
            P
Sbjct: 228 LP 229


>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
           (MEKK2) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK2 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
           (JNK) and p38 through their respective MAPKKs MEK1/2,
           JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
           roles in T cell receptor signaling, immune synapse
           formation, cytokine gene expression, as well as in EGF
           and FGF receptor signaling.
          Length = 265

 Score = 35.8 bits (82), Expect = 9e-04
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +M+PE++ G   YG   D+W+VGC + E+L +    P  ++ + +  IF+    P+    
Sbjct: 175 WMSPEVISG-EGYGRKADIWSVGCTVVEMLTEK---PPWAEFEAMAAIFKIATQPTNPVL 230

Query: 71  P 71
           P
Sbjct: 231 P 231


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 35.9 bits (82), Expect = 0.001
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 11  FMAPELLFG-ARMYGVGIDMWAVGCIICELLL-KAPF 45
           + +PELL    + Y    DMWA+GCII EL   K PF
Sbjct: 207 YWSPELLLHETKSYDDKSDMWALGCIIYELCSGKTPF 243


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 35.5 bits (82), Expect = 0.001
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIF 59
           +MAPE++     YG+  D+W++GC + E+   K P+    S L+ +  +F
Sbjct: 167 WMAPEVIAQQGGYGLAADIWSLGCTVLEMATGKPPW----SQLEGVAAVF 212


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
           (NDR) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The NDR subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. NDR kinases
           regulate mitosis, cell growth, embryonic development,
           and neurological processes. They are also required for
           proper centrosome duplication. Higher eukaryotes contain
           two NDR isoforms, NDR1 and NDR2. This subfamily also
           contains fungal NDR-like kinases.
          Length = 364

 Score = 35.4 bits (82), Expect = 0.001
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 18/81 (22%)

Query: 2   QNWKKVRKA----------FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD 51
           + WK+ R+A          ++APE+ F    Y    D W++G I+ E+L+  P  P  SD
Sbjct: 186 ETWKRNRRALAYSTVGTPDYIAPEV-FLQTGYNKECDWWSLGVIMYEMLVGYP--PFCSD 242

Query: 52  LDQLT--RIF---QTLGTPSE 67
             Q T  +I    +TL  P E
Sbjct: 243 NPQETYRKIINWKETLQFPDE 263


>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase 2.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, MSK2,
           N-terminal catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MSK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MSKs contain an N-terminal kinase domain (NTD)
           from the AGC family and a C-terminal kinase domain (CTD)
           from the CAMK family, similar to 90 kDa ribosomal
           protein S6 kinases (RSKs). MSKs are activated by two
           major signaling cascades, the Ras-MAPK and p38 stress
           kinase pathways, which trigger phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) of NTD,
           which facilitates the phosphorylation of the A-loop and
           activates the NTD, which in turn phosphorylates
           downstream targets. MSK2 and MSK1 play nonredundant
           roles in activating histone H3 kinases, which play
           pivotal roles in compaction of the chromatin fiber. MSK2
           is the required H3 kinase in response to stress stimuli
           and activation of the p38 MAPK pathway. MSK2 also plays
           a role in the pathogenesis of psoriasis.
          Length = 332

 Score = 35.3 bits (81), Expect = 0.001
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKA-PF-LPGESD 51
           +MAPE++ G   +G  +D W++G +I ELL  A PF L GE +
Sbjct: 172 YMAPEIIRGKGGHGKAVDWWSLGILIFELLTGASPFTLEGERN 214


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 35.0 bits (81), Expect = 0.001
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 9   KAFMAPELLFGARMYGVGIDMWAVGCIICEL-LLKAPF----LPGESDLDQLTRIFQ 60
            ++MAPE + G   Y V  D+W++G  + EL   + P+     P +   + L  I  
Sbjct: 163 SSYMAPERIQGND-YSVKSDIWSLGLSLIELATGRFPYPPENDPPDGIFELLQYIVN 218


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 34.9 bits (81), Expect = 0.002
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGES 50
            +M+PE + G   Y    D+W++G  + E  L K PFLP   
Sbjct: 165 TYMSPERIQG-ESYSYAADIWSLGLTLLECALGKFPFLPPGQ 205


>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional.
          Length = 467

 Score = 34.9 bits (80), Expect = 0.002
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 11  FMAPELLFG-ARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGT-PSE 67
           + +PE++ G   MY    DMW++GCII EL           +L+ L  + +TLG  PSE
Sbjct: 311 YRSPEVVLGLGWMYST--DMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLGRLPSE 367


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK3 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK3 plays an essential role in embryonic angiogenesis
           and early heart development. In addition, MEKK3 is
           involved in interleukin-1 receptor and Toll-like
           receptor 4 signaling. It is also a specific regulator of
           the proinflammatory cytokines IL-6 and GM-CSF in some
           immune cells. MEKK3 also regulates calcineurin, which
           plays a critical role in T cell activation, apoptosis,
           skeletal myocyte differentiation, and cardiac
           hypertrophy.
          Length = 266

 Score = 34.7 bits (79), Expect = 0.002
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +M+PE++ G   YG   D+W++GC + E+L +    P  ++ + +  IF+    P+    
Sbjct: 175 WMSPEVISG-EGYGRKADVWSLGCTVVEMLTEK---PPWAEYEAMAAIFKIATQPTNPQL 230

Query: 71  PT 72
           P+
Sbjct: 231 PS 232


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 34.4 bits (79), Expect = 0.002
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +MAPE+L G   Y   +D +A+GC + E++  ++PF
Sbjct: 160 YMAPEVLQGEV-YDFSVDWFALGCTLYEMIAGRSPF 194


>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Citron Rho-interacting kinase. 
           Serine/Threonine Kinases (STKs), Citron Rho-interacting
           kinase (CRIK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The CRIK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CRIK is also called citron kinase. It contains
           a catalytic domain, a central coiled-coil domain, and a
           C-terminal region containing a Rho-binding domain (RBD),
           a zinc finger, and a pleckstrin homology (PH) domain, in
           addition to other motifs. CRIK, an effector of the small
           GTPase Rho, plays an important function during
           cytokinesis and affects its contractile process.
           CRIK-deficient mice show severe ataxia and epilepsy as a
           result of abnormal cytokinesis and massive apoptosis in
           neuronal precursors. A Down syndrome critical region
           protein TTC3 interacts with CRIK and inhibits
           CRIK-dependent neuronal differentiation and neurite
           extension.
          Length = 330

 Score = 34.4 bits (79), Expect = 0.003
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 6/46 (13%)

Query: 11  FMAPELL-----FGARMYGVGIDMWAVGCIICELLL-KAPFLPGES 50
           ++APE+L      G   YGV  D W++G I  E++  ++PF  G S
Sbjct: 169 YIAPEVLTTMNGDGKGTYGVECDWWSLGVIAYEMIYGRSPFHEGTS 214


>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C iota.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, iota isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-iota is directly implicated in carcinogenesis. It is
           critical to oncogenic signaling mediated by Ras and
           Bcr-Abl. The PKC-iota gene is the target of
           tumor-specific gene amplification in many human cancers,
           and has been identified as a human oncogene. In addition
           to its role in transformed growth, PKC-iota also
           promotes invasion, chemoresistance, and tumor cell
           survival. Expression profiling of PKC-iota is a
           prognostic marker of poor clinical outcome in several
           human cancers. PKC-iota also plays a role in
           establishing cell polarity, and has critical embryonic
           functions.
          Length = 329

 Score = 34.3 bits (78), Expect = 0.003
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 6/57 (10%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF-LPGESD-LDQLTR--IFQTL 62
           ++APE+L G   YG  +D WA+G ++ E++  ++PF + G SD  DQ T   +FQ +
Sbjct: 162 YIAPEILRGED-YGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVI 217


>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 5.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK5
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK5 is widely expressed in many tissues.
           It associates with the membrane though an N-terminal
           PIP2 binding domain and also binds phospholipids via its
           C-terminus. GRK5 deficiency is associated with early
           Alzheimer's disease in humans and mouse models. GRK5
           also plays a crucial role in the pathogenesis of
           sporadic Parkinson's disease. It participates in the
           regulation and desensitization of PDGFRbeta, a receptor
           tyrosine kinase involved in a variety of downstream
           cellular effects including cell growth, chemotaxis,
           apoptosis, and angiogenesis. GRK5 also regulates
           Toll-like receptor 4, which is involved in innate and
           adaptive immunity.
          Length = 285

 Score = 34.2 bits (78), Expect = 0.004
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
            +MAPE+L   R Y +  D W +GC+I E++  ++PF
Sbjct: 166 GYMAPEVLNNQR-YTLSPDYWGLGCLIYEMIEGQSPF 201


>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
           kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain,
           functionally uncharacterized subgroup 1. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MEKK3-like subfamily is
           composed of MEKK3, MEKK2, and related proteins, all
           containing an N-terminal PB1 domain, which mediates
           oligomerization, and a C-terminal catalytic domain.
           MEKK2 and MEKK3 are mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
           proteins that phosphorylate and activate MAPK kinases
           (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
           and activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK2 and MEKK3 activate MEK5
           (also called MKK5), which activates extracellular
           signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
           roles in promoting cell proliferation, differentiation,
           neuronal survival, and neuroprotection. MEKK3 plays an
           essential role in embryonic angiogenesis and early heart
           development. MEKK2 and MEKK3 can also activate the
           MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
           their respective MAPKKs.
          Length = 264

 Score = 33.8 bits (77), Expect = 0.004
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTW 70
           +M+PE++ G   YG   D+W+V C + E+L +    P  ++ + +  IF+    P++   
Sbjct: 175 WMSPEVISG-EGYGRKADVWSVACTVVEMLTEK---PPWAEYEAMAAIFKIATQPTKPML 230

Query: 71  P 71
           P
Sbjct: 231 P 231


>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C zeta.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, zeta isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-zeta plays a critical role in activating the glucose
           transport response. It is activated by glucose, insulin,
           and exercise through diverse pathways. PKC-zeta also
           plays a central role in maintaining cell polarity in
           yeast and mammalian cells. In addition, it affects actin
           remodeling in muscle cells.
          Length = 327

 Score = 33.9 bits (77), Expect = 0.005
 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF--LPGESDLDQLTRIFQTL 62
           ++APE+L G   YG  +D WA+G ++ E++  ++PF  +    D++    +FQ +
Sbjct: 162 YIAPEILRGEE-YGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVI 215


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           alpha.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, alpha isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           PKC-alpha is expressed in many tissues and is associated
           with cell proliferation, apoptosis, and cell motility.
           It plays a role in the signaling of the growth factors
           PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
           have been detected in many transformed cell lines and
           several human tumors. In addition, PKC-alpha is required
           for HER2 dependent breast cancer invasion.
          Length = 323

 Score = 33.4 bits (76), Expect = 0.007
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           ++APE++   + YG  +D WA G ++ E+L   P   GE D D+L   FQ++
Sbjct: 167 YIAPEII-AYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE-DEDEL---FQSI 213


>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C theta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), theta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta
           is selectively expressed in T-cells and plays an
           important and non-redundant role in several aspects of
           T-cell biology. Although T-cells also express other PKC
           isoforms, PKC-theta is unique in that upon antigen
           stimulation, it is translocated to the plasma membrane
           at the immunological synapse, where it mediates signals
           essential for T-cell activation. It is essential for
           TCR-induced proliferation, cytokine production, T-cell
           survival, and the differentiation and effector function
           of T-helper (Th) cells, particularly Th2 and Th17.
           PKC-theta is being developed as a therapeutic target for
           Th2-mediated allergic inflammation and Th17-mediated
           autoimmune diseases.
          Length = 316

 Score = 33.0 bits (75), Expect = 0.008
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L G + Y   +D W+ G ++ E+L+ ++PF
Sbjct: 162 YIAPEILLGQK-YNTSVDWWSFGVLLYEMLIGQSPF 196


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 33.0 bits (76), Expect = 0.008
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 5/35 (14%)

Query: 12  MAPELLFGARMYGVGI--DMWAVGCIICELLLKAP 44
           MAPE++    M G     D+W++GC + ELL   P
Sbjct: 166 MAPEVI---EMSGASTASDIWSLGCTVIELLTGNP 197


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 32.9 bits (76), Expect = 0.009
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           +MAPE++ G   Y    D+W++G    EL    P
Sbjct: 163 WMAPEVINGKP-YDYKADIWSLGITAIELAEGKP 195


>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 7.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK7
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs
           to the visual group of GRKs. It is primarily found in
           the retina and plays a role in the regulation of opsin
           light receptors. GRK7 is located in retinal cone outer
           segments and plays an important role in regulating
           photoresponse of the cones.
          Length = 277

 Score = 32.6 bits (74), Expect = 0.010
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 9   KAFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
             +MAPE+L     Y   +D +A+GC I E++  + PF
Sbjct: 158 NGYMAPEILK-EEPYSYPVDWFAMGCSIYEMVAGRTPF 194


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase C.  Serine/Threonine Kinases
           (STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, classical PKCs depend on
           calcium, DAG (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. Novel PKCs are
           calcium-independent, but require DAG and PS for
           activity, while atypical PKCs only require PS. PKCs
           phosphorylate and modify the activities of a wide
           variety of cellular proteins including receptors,
           enzymes, cytoskeletal proteins, transcription factors,
           and other kinases. They play a central role in signal
           transduction pathways that regulate cell migration and
           polarity, proliferation, differentiation, and apoptosis.
           Also included in this subfamily are the PKC-like
           proteins, called PKNs.
          Length = 318

 Score = 32.3 bits (74), Expect = 0.013
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 4/46 (8%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQL 55
           ++APE+L   + YG  +D WA+G ++ E+L  ++PF  G+ D D+L
Sbjct: 162 YIAPEILSY-QPYGPAVDWWALGVLLYEMLAGQSPF-EGD-DEDEL 204


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 32.5 bits (74), Expect = 0.013
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APE + G     +  D W++GC+I E L   P
Sbjct: 159 YLAPETILGVGDDKMS-DWWSLGCVIFEFLFGYP 191


>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Atypical Protein Kinase
           C (aPKC) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           aPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. aPKCs only require
           phosphatidylserine (PS) for activation. They contain a
           C2-like region, instead of a calcium-binding (C2) region
           found in classical PKCs, in their regulatory domain.
           There are two aPKC isoforms, zeta and iota. aPKCs are
           involved in many cellular functions including
           proliferation, migration, apoptosis, polarity
           maintenance and cytoskeletal regulation. They also play
           a critical role in the regulation of glucose metabolism
           and in the pathogenesis of type 2 diabetes.
          Length = 329

 Score = 32.5 bits (74), Expect = 0.014
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 6/57 (10%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF-LPGESDL-DQLTR--IFQTL 62
           ++APE+L G   YG  +D WA+G ++ E++  ++PF + G SD  DQ T   +FQ +
Sbjct: 162 YIAPEILRGED-YGFSVDWWALGVLMFEMMAGRSPFDIVGMSDNPDQNTEDYLFQVI 217


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 32.3 bits (73), Expect = 0.016
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           +MAPE++  +R+ YG  +D+W++G ++ E++   P    E  L  + RI   L
Sbjct: 184 WMAPEVI--SRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNL 234


>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C eta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), eta isoform, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta
           is predominantly expressed in squamous epithelia, where
           it plays a crucial role in the signaling of cell-type
           specific differentiation. It is also expressed in pro-B
           cells and early-stage thymocytes, and acts as a key
           regulator in early B-cell development. PKC-eta increases
           glioblastoma multiforme (GBM) proliferation and
           resistance to radiation, and is being developed as a
           therapeutic target for the management of GBM.
          Length = 320

 Score = 32.2 bits (73), Expect = 0.016
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L    +YG  +D WA+G ++ E+L   APF
Sbjct: 162 YIAPEIL-QEMLYGPSVDWWAMGVLLYEMLCGHAPF 196


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
           Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Bck1-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
           pombe Mkh1, and related proteins. MAPKKKs phosphorylate
           and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
           which in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Budding
           yeast Bck1 is part of the cell integrity MAPK pathway,
           which is activated by stresses and aggressions to the
           cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
           the MAPK Slt2 make up the cascade that is important in
           the maintenance of cell wall homeostasis. Fission yeast
           Mkh1 is involved in MAPK cascades regulating cell
           morphology, cell wall integrity, salt resistance, and
           filamentous growth in response to stress.
          Length = 272

 Score = 32.1 bits (73), Expect = 0.016
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 7/56 (12%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIFQTLGT 64
           +MAPE++      Y   +D+W++GC++ E+   + P+    SD + +  +F+ LG 
Sbjct: 176 WMAPEVIHSYSQGYSAKVDIWSLGCVVLEMFAGRRPW----SDEEAIAAMFK-LGN 226


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 8.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek8 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek8 contains an
           N-terminal kinase catalytic domain and a C-terminal RCC1
           (regulator of chromosome condensation) domain. A double
           point mutation in Nek8 causes cystic kidney disease in
           mice that genetically resembles human autosomal
           recessive polycystic kidney disease (ARPKD). Nek8 is
           also associated with a rare form of juvenile renal
           cystic disease, nephronophthisis type 9. It has been
           suggested that a defect in the ciliary localization of
           Nek8 contributes to the development of cysts manifested
           by these diseases.
          Length = 256

 Score = 32.1 bits (73), Expect = 0.018
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +++PEL  G + Y    D+WA+GC++ EL  LK  F
Sbjct: 167 YISPELCEG-KPYNQKSDIWALGCVLYELASLKRAF 201


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 31.9 bits (73), Expect = 0.021
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 1   MQNWKKVRKAF------MAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
               +KVRK F      MAPE++     Y    D+W+ G    EL    AP+
Sbjct: 156 GDRTRKVRKTFVGTPCWMAPEVMEQVHGYDFKADIWSFGITAIELATGAAPY 207


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 31.6 bits (72), Expect = 0.023
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +MAPE+  G R Y    D+W++GC++ E+     PF
Sbjct: 167 YMAPEVWKG-RPYSYKSDIWSLGCLLYEMATFAPPF 201


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 31.6 bits (72), Expect = 0.029
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQL 55
           +MAPE++   + Y    D+W++G  I E+   A   P  SD+D  
Sbjct: 167 WMAPEVITEGKYYDTKADIWSLGITIYEM---ATGNPPYSDVDAF 208


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinases, Never In Mitosis gene
           A-related kinase 6 and 7.  Serine/Threonine Kinases
           (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
           (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The Nek6/7 subfamily is part of a family of 11 different
           Neks (Nek1-11) that are involved in cell cycle control.
           The Nek family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek6 and Nek7 are the shortest Neks,
           consisting only of the catalytic domain and a very short
           N-terminal extension. They show distinct expression
           patterns and both appear to be downstream substrates of
           Nek9. They are required for mitotic spindle formation
           and cytokinesis. They may also be regulators of the p70
           ribosomal S6 kinase.
          Length = 267

 Score = 31.3 bits (71), Expect = 0.035
 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +M+PE +     Y    D+W++GC++ E+  L++PF
Sbjct: 172 YMSPERIHENG-YNFKSDIWSLGCLLYEMAALQSPF 206


>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C delta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), delta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta
           plays a role in cell cycle regulation and programmed
           cell death in many cell types. It slows down cell
           proliferation, inducing cell cycle arrest and enhancing
           cell differentiation. PKC-delta is also involved in the
           regulation of transcription as well as immune and
           inflammatory responses. It plays a central role in the
           genotoxic stress response that leads to DNA
           damaged-induced apoptosis.
          Length = 316

 Score = 31.1 bits (70), Expect = 0.036
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQLTRIFQTL--GTPSE 67
           ++APE+L G + Y   +D W+ G ++ E+L+ ++PF   + D      +F+++   TP  
Sbjct: 162 YIAPEILQGLK-YTFSVDWWSFGVLLYEMLIGQSPFHGDDED-----ELFESIRVDTPHY 215

Query: 68  DTWPTAGVKGLF 79
             W T   K + 
Sbjct: 216 PRWITKESKDIL 227


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score = 31.3 bits (71), Expect = 0.037
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLD 53
           +M+PE + G + Y V  D+W++G  I EL L K PF     D D
Sbjct: 168 YMSPERIQGGK-YTVKSDVWSLGISIIELALGKFPFAFSNIDDD 210


>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
          Length = 478

 Score = 31.1 bits (70), Expect = 0.043
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           ++APEL    R Y    DMW++G I+ ELL L  PF
Sbjct: 237 YLAPELWERKR-YSKKADMWSLGVILYELLTLHRPF 271


>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 6.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK6
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK6 is widely expressed in many tissues.
           t is expressed as multiple splice variants with
           different domain architectures. It is
           post-translationally palmitoylated and localized in the
           membrane. GRK6 plays important roles in the regulation
           of dopamine, M3 muscarinic, opioid, and chemokine
           receptor signaling. It also plays maladaptive roles in
           addiction and Parkinson's disease. GRK6-deficient mice
           exhibit altered dopamine receptor regulation, decreased
           lymphocyte chemotaxis, and increased acute inflammation
           and neutrophil chemotaxis.
          Length = 285

 Score = 30.8 bits (69), Expect = 0.048
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
            +MAPE++   R Y    D WA+GC++ E++  ++PF
Sbjct: 166 GYMAPEVVKNER-YTFSPDWWALGCLLYEMIAGQSPF 201


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 30.9 bits (70), Expect = 0.049
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRI 58
           +MAPE++  +R+ YG  +D+W++G ++ E++   P    E  L  + RI
Sbjct: 181 WMAPEVI--SRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMKRI 227


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 1.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 1, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK1 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK1 is
           important in the regulation of many cellular processes
           including cytoskeletal dynamics, cell motility, growth,
           and proliferation. Although PAK1 has been regarded
           mainly as a cytosolic protein, recent reports indicate
           that PAK1 also exists in significant amounts in the
           nucleus, where it is involved in transcription
           modulation and in cell cycle regulatory events. PAK1 is
           also involved in transformation and tumorigenesis. Its
           overexpression, hyperactivation and increased nuclear
           accumulation is correlated to breast cancer invasiveness
           and progression. Nuclear accumulation is also linked to
           tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 30.8 bits (69), Expect = 0.050
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           +MAPE++   + YG  +D+W++G +  E++   P    E+ L  L  I  T GTP
Sbjct: 182 WMAPEVV-TRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLI-ATNGTP 234


>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 4.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek4 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. Nek4 is highly abundant in the
           testis. Its specific function is unknown.
          Length = 257

 Score = 30.7 bits (69), Expect = 0.056
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICEL-LLKAPF 45
           +M+PEL F  + Y    D+WA+GC + E+  LK  F
Sbjct: 168 YMSPEL-FSNKPYNYKSDVWALGCCVYEMATLKHAF 202


>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           beta.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, beta isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           The PKC beta isoforms (I and II), generated by
           alternative splicing of a single gene, are
           preferentially activated by hyperglycemia-induced DAG in
           retinal tissues. This is implicated in diabetic
           microangiopathy such as ischemia, neovascularization,
           and abnormal vasodilator function. PKC-beta also plays
           an important role in VEGF signaling. In addition,
           glucose regulates proliferation in retinal endothelial
           cells via PKC-betaI. PKC-beta is also being explored as
           a therapeutic target in cancer. It contributes to tumor
           formation and is involved in the tumor host mechanisms
           of inflammation and angiogenesis.
          Length = 323

 Score = 30.7 bits (69), Expect = 0.057
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           ++APE++   + YG  +D WA G ++ E+L       GE D D+L   FQ++
Sbjct: 167 YIAPEII-AYQPYGKSVDWWAFGVLLYEMLAGQAPFEGE-DEDEL---FQSI 213


>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine-like kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST-like (MASTL) kinases, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAST kinases contain an N-terminal domain of
           unknown function, a central catalytic domain, and a
           C-terminal PDZ domain that mediates protein-protein
           interactions. The MASTL kinases in this group carry only
           a catalytic domain, which contains a long insertion
           relative to MAST kinases. The human MASTL gene has also
           been labelled FLJ14813. A missense mutation in FLJ14813
           is associated with autosomal dominant thrombocytopenia.
           To date, the function of MASTL is unknown.
          Length = 669

 Score = 30.6 bits (69), Expect = 0.060
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APELL G + +G  +D WA+G  + E L   P
Sbjct: 546 YLAPELLLG-KPHGPAVDWWALGVCLFEFLTGIP 578


>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
           Dbf2-Related kinase-like Protein Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), NDR kinase
           subfamily, fungal NDR-like proteins, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The NDR subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This group is
           composed of fungal NDR-like proteins including
           Saccharomyces cerevisiae CBK1 (or CBK1p),
           Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago
           maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like
           NDR kinase, group members contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. CBK1 is an essential component in the RAM
           (regulation of Ace2p activity and cellular
           morphogenesis) network. CBK1 and Orb6 play similar roles
           in coordinating cell morphology with cell cycle
           progression. Ukc1 is involved in morphogenesis,
           pathogenicity, and pigment formation. Cot1 plays a role
           in polar tip extension.
          Length = 377

 Score = 30.6 bits (69), Expect = 0.063
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 14/80 (17%)

Query: 1   MQNWKKVRKA----------FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGES 50
           +  WKK R+           ++APE+ F  + YG   D W++G I+ E L+  P    E+
Sbjct: 194 IATWKKNRRLMAYSTVGTPDYIAPEI-FLQQGYGQECDWWSLGAIMFECLIGWPPFCSEN 252

Query: 51  DLDQLTRIF---QTLGTPSE 67
             +   +I    +TL  P +
Sbjct: 253 SHETYRKIINWRETLYFPDD 272


>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 5.  Protein kinases (PKs), MAP
           kinase kinase 5 (MKK5) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK5 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a
           dual-specificity PK that phosphorylates its downstream
           target, extracellular signal-regulated kinase 5 (ERK5),
           on specific threonine and tyrosine residues. MKK5 is
           activated by MEKK2 and MEKK3 in response to mitogenic
           and stress stimuli. The ERK5 cascade promotes cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. This cascade plays an essential role in
           heart development. Mice deficient in either ERK5 or MKK5
           die around embryonic day 10 due to cardiovascular
           defects including underdevelopment of the myocardium. In
           addition, MKK5 is associated with metastasis and
           unfavorable prognosis in prostate cancer.
          Length = 279

 Score = 30.2 bits (68), Expect = 0.069
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL 41
           A+MAPE + G + YG+  D+W++G    EL L
Sbjct: 158 AYMAPERISGEQ-YGIHSDVWSLGISFMELAL 188


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 30.5 bits (68), Expect = 0.071
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           +MAPE++   + YG  +D+W++G +  E++   P    E+ L  L  I  T GTP
Sbjct: 181 WMAPEVV-TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLI-ATNGTP 233


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 30.2 bits (68), Expect = 0.071
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 9   KAFMAPELLFGARM-----YGVGIDMWAVGCIICELLLKA-PFLPGESD--LDQLTRIFQ 60
           +++MAPE +          Y V  D+W++G  I E+ L   P+ P        QL+ I  
Sbjct: 165 QSYMAPERIKSGGPNQNPTYTVQSDVWSLGLSILEMALGRYPYPPETYANIFAQLSAIVD 224

Query: 61  TLGTP 65
             G P
Sbjct: 225 --GDP 227


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 30.5 bits (68), Expect = 0.079
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           +MAPE++   + YG  +D+W++G +  E++   P    E+ L  L  I  T GTP
Sbjct: 181 WMAPEVV-TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLI-ATNGTP 233


>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein
           Serine/Threonine Kinases, Novel Protein Kinase C theta
           and delta.  Serine/Threonine Kinases (STKs), Novel
           Protein Kinase C (nPKC), theta and delta-like isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The nPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           nPKCs are calcium-independent, but require DAG
           (1,2-diacylglycerol) and phosphatidylserine (PS) for
           activity. There are four nPKC isoforms, delta, epsilon,
           eta, and theta. PKC-theta is selectively expressed in
           T-cells and plays an important and non-redundant role in
           several aspects of T-cell biology. PKC-delta plays a
           role in cell cycle regulation and programmed cell death
           in many cell types.
          Length = 316

 Score = 30.1 bits (68), Expect = 0.086
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 4/46 (8%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGESDLDQL 55
           ++APE+L G + Y   +D W+ G ++ E+L+ ++PF  GE D D+L
Sbjct: 162 YIAPEILKGQK-YNESVDWWSFGVLLYEMLIGQSPF-HGE-DEDEL 204


>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C epsilon.
            Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), epsilon isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta.
           PKC-epsilon has been shown to behave as an oncoprotein.
           Its overexpression contributes to neoplastic
           transformation depending on the cell type. It
           contributes to oncogenesis by inducing disordered cell
           growth and inhibiting cell death. It also plays a role
           in tumor invasion and metastasis. PKC-epsilon has also
           been found to confer cardioprotection against ischemia
           and reperfusion-mediated damage. Other cellular
           functions include the regulation of gene expression,
           cell adhesion, and cell motility.
          Length = 321

 Score = 30.2 bits (68), Expect = 0.095
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD 51
           ++APE+L     YG  +D WA+G ++ E++   P  P E+D
Sbjct: 162 YIAPEIL-QELEYGPSVDWWALGVLMYEMMAGQP--PFEAD 199


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           LATS subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. LATS was originally identified in Drosophila
           using a screen for genes whose inactivation led to
           overproliferation of cells. In tetrapods, there are two
           LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
           mice results in the development of various tumors,
           including sarcomas and ovarian cancer. LATS functions as
           a tumor suppressor and is implicated in cell cycle
           regulation.
          Length = 376

 Score = 30.2 bits (68), Expect = 0.097
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 7/47 (14%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLL-KAPFL---PGESDL 52
           ++APE+L   R  Y    D W+VG I+ E+L+ + PFL   P E+ L
Sbjct: 210 YIAPEVL--LRTGYTQLCDWWSVGVILYEMLVGQPPFLADTPAETQL 254


>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family,
           similar to 90 kDa ribosomal protein S6 kinases (RSKs).
           MSKs are activated by two major signaling cascades, the
           Ras-MAPK and p38 stress kinase pathways, in response to
           various stimuli such as growth factors, hormones,
           neurotransmitters, cellular stress, and pro-inflammatory
           cytokines. This triggers phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) in the
           C-terminal extension of NTD, which facilitates the
           phosphorylation of the A-loop and activates the NTD,
           which in turn phosphorylates downstream targets. MSKs
           are predominantly nuclear proteins. They are widely
           expressed in many tissues including heart, brain, lung,
           liver, kidney, and pancreas. There are two isoforms of
           MSK, called MSK1 and MSK2.
          Length = 288

 Score = 29.8 bits (67), Expect = 0.099
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 11  FMAPELL-FGARMYGVGIDMWAVGCIICELLLKA-PF 45
           +MAPE++  G+  +   +D W++G +  ELL  A PF
Sbjct: 172 YMAPEVIRGGSGGHDKAVDWWSLGVLTFELLTGASPF 208


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 29.9 bits (67), Expect = 0.11
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIF 59
           +MAPE++     YG   D+W++GC + E+    P L   + +D+L  +F
Sbjct: 174 WMAPEVI-NESGYGRKSDIWSIGCTVFEMATGKPPL---ASMDRLAAMF 218


>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 10.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 10 (Nek10)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek10 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. No function has yet been ascribed to Nek10.
           The gene encoding Nek10 is a putative causative gene for
           breast cancer; it is located within a breast cancer
           susceptibility loci on chromosome 3p24.
          Length = 269

 Score = 29.8 bits (67), Expect = 0.11
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 23  YGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP-SEDTWPT 72
           YG   D+WA GCI+ ++    P     + L   T+I + +  P  E  +  
Sbjct: 190 YGEKADVWAFGCILYQMCTLQPPFYSTNMLSLATKIVEAVYEPLPEGMYSE 240


>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional.
          Length = 391

 Score = 30.0 bits (67), Expect = 0.11
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 11/64 (17%)

Query: 13  APELLFGAR-MYGVGIDMWAVGCIICEL------LLKAPFLPGESDLD-QLTRIFQTLGT 64
           APELL  AR  YG  +D+W+ G ++ E+      L +   L G+ D D Q+  I +  GT
Sbjct: 251 APELL--ARDPYGPAVDIWSAGIVLFEMATCHDSLFEKDGLDGDCDSDRQIKLIIRRSGT 308

Query: 65  -PSE 67
            P+E
Sbjct: 309 HPNE 312


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 5.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek5 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. The specific function of Nek5
           is unknown.
          Length = 257

 Score = 29.5 bits (66), Expect = 0.13
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           +++PE+    R Y    D+W++GC++ EL  LK PF
Sbjct: 168 YLSPEIC-QNRPYNNKTDIWSLGCVLYELCTLKHPF 202


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Classical (or
           Conventional) Protein Kinase C (cPKC) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. cPKCs contain a
           calcium-binding C2 region in their regulatory domain.
           There are four cPKC isoforms, named alpha, betaI,
           betaII, and gamma. cPKCs are potent kinases for
           histones, myelin basic protein, and protamine. PKC-gamma
           is mainly expressed in neuronal tissues. It plays a role
           in protection from ischemia.
          Length = 324

 Score = 29.7 bits (67), Expect = 0.14
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           ++APE++   + YG  +D WA G ++ E+L   P   GE D D+L   FQ++
Sbjct: 167 YIAPEII-AYQPYGKSVDWWAFGVLLYEMLAGQPPFDGE-DEDEL---FQSI 213


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 29.5 bits (67), Expect = 0.15
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
            +MAPE++     YG  +D+W++G +  E+    P    E  L  L  I  T G P
Sbjct: 181 YWMAPEVIKRKD-YGPKVDIWSLGIMCIEMAEGEPPYLREPPLRALFLI-TTKGIP 234


>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 2.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           LATS2 is an essential mitotic regulator responsible for
           coordinating accurate cytokinesis completion and
           governing the stabilization of other mitotic regulators.
           It is also critical in the maintenance of proper
           chromosome number, genomic stability, mitotic fidelity,
           and the integrity of centrosome duplication.
           Downregulation of LATS2 is associated with poor
           prognosis in acute lymphoblastic leukemia and breast
           cancer.
          Length = 381

 Score = 29.6 bits (66), Expect = 0.15
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 6/61 (9%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFL---PGESDLDQLTRIFQTLGTPS 66
           ++APE+L   + Y    D W+VG I+ E+L+ + PFL   P E+ L ++     TL  P 
Sbjct: 214 YIAPEVLL-RKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQL-KVINWENTLHIPP 271

Query: 67  E 67
           +
Sbjct: 272 Q 272


>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 1.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK1
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK1, also called rhodopsin kinase,
           belongs to the visual group of GRKs and is expressed in
           retinal cells. It phosphorylates rhodopsin in rod cells,
           which leads to termination of the phototransduction
           cascade. Mutations in GRK1 are associated to a
           recessively inherited form of stationary nightblindness
           called Oguchi disease.
          Length = 280

 Score = 29.4 bits (66), Expect = 0.15
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPF 45
           FMAPELL G   Y   +D +A+G  + E++  + PF
Sbjct: 163 FMAPELLQGEE-YDFSVDYFALGVTLYEMIAARGPF 197


>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), cAMP-dependent protein kinase (PKA) subfamily,
           PRKX-like kinases, catalytic (c) subunit. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include human PRKX (X
           chromosome-encoded protein kinase), Drosophila DC2, and
           similar proteins. PRKX is present in many tissues
           including fetal and adult brain, kidney, and lung. The
           PRKX gene is located in the Xp22.3 subregion and has a
           homolog called PRKY on the Y chromosome. An abnormal
           interchange between PRKX aand PRKY leads to the sex
           reversal disorder of XX males and XY females. PRKX is
           implicated in granulocyte/macrophage lineage
           differentiation, renal cell epithelial migration, and
           tubular morphogenesis in the developing kidney.
          Length = 291

 Score = 29.3 bits (66), Expect = 0.19
 Identities = 12/36 (33%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE++  ++ +   +D WA+G +I E+L+   PF
Sbjct: 164 YLAPEVI-QSKGHNKAVDWWALGILIYEMLVGYPPF 198


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 7.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek7 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek7 is required
           for mitotic spindle formation and cytokinesis. It is
           enriched in the centrosome and is critical for
           microtubule nucleation. Nek7 is activated by Nek9 during
           mitosis, and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 29.2 bits (65), Expect = 0.20
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICEL-LLKAPFLPGESDLDQLTRIFQTLGTP 65
           +M+PE +     Y    D+W++GC++ E+  L++PF   + +L  L +  +    P
Sbjct: 172 YMSPERIH-ENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYP 226


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 29.1 bits (65), Expect = 0.20
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTP 65
           +MAPE++   + YG  +D+W++G +  E++   P    E+ L  L  I  T GTP
Sbjct: 181 WMAPEVV-TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLI-ATNGTP 233


>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 4.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK4
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK4 has a limited tissue distribution. It
           is mainly found in the testis, but is also present in
           the cerebellum and kidney. It is expressed as multiple
           splice variants with different domain architectures. It
           is post-translationally palmitoylated and localized in
           the membrane. GRK4 polymorphisms are associated with
           hypertension and salt sensitivity, as they cause
           hyperphosphorylation, desensitization, and
           internalization of the dopamine 1 (D1) receptor while
           increasing the expression of the angiotensin II type 1
           receptor. GRK4 plays a crucial role in the D1 receptor
           regulation of sodium excretion and blood pressure.
          Length = 285

 Score = 29.2 bits (65), Expect = 0.20
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +MAPE++   + Y    D W +GC+I E++  ++PF
Sbjct: 167 YMAPEVINNEK-YTFSPDWWGLGCLIYEMIQGQSPF 201


>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAST kinases contain an
           N-terminal domain of unknown function, a central
           catalytic domain, and a C-terminal PDZ domain that
           mediates protein-protein interactions. There are four
           mammalian MAST kinases, named MAST1-MAST4. MAST1 is also
           referred to as syntrophin-associated STK (SAST), while
           MAST2 is also called MAST205. MAST kinases are
           cytoskeletal associated kinases of unknown function that
           are also expressed at neuromuscular junctions and
           postsynaptic densities. MAST1, MAST2, and MAST3 bind and
           phosphorylate the tumor suppressor PTEN, and may
           contribute to the regulation and stabilization of PTEN.
           MAST2 is involved in the regulation of the Fc-gamma
           receptor of the innate immune response in macrophages,
           and may also be involved in the regulation of the Na+/H+
           exchanger NHE3.
          Length = 305

 Score = 29.0 bits (65), Expect = 0.21
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGES 50
           ++APE++   + YG  +D WA+G I+ E L+      G++
Sbjct: 182 YIAPEVIL-RQGYGKPVDWWAMGIILYEFLVGCVPFFGDT 220


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
           cAMP-dependent protein kinase-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), Fission yeast Suppressor of loss of
           cAMP-dependent protein kinase (Sck1)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sck1-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of fungal proteins
           with similarity to the Schizosaccharomyces pombe STK
           Sck1. Sck1 plays a role in trehalase activation
           triggered by glucose and a nitrogen source. Trehalase
           catalyzes the cleavage of the disaccharide trehalose to
           glucose. Trehalose, as a carbohydrate reserve and stress
           metabolite, plays an important role in the response of
           yeast to environmental changes.
          Length = 330

 Score = 29.1 bits (65), Expect = 0.23
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICEL 39
           ++APE+L   + Y   +D W++G ++ E+
Sbjct: 162 YLAPEVLLDEKGYTKHVDFWSLGVLVFEM 190


>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 3.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK3
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK3 (also known as beta-adrenergic
           receptor kinase 2) is widely expressed in many tissues.
           GRK3-deficient mice show a lack of olfactory receptor
           desensitization and altered regulation of the M2
           muscarinic airway. GRK3 is involved in modulating the
           cholinergic response of airway smooth muscles. It also
           plays a role in dopamine receptor regulation. GRK3
           promoter polymorphisms may be associated with bipolar
           disorder.
          Length = 279

 Score = 28.8 bits (64), Expect = 0.23
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 10  AFMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGES-DLDQLTRIFQTLGTPSE 67
            +MAPE+L     Y    D +++GC++ +LL   +PF   ++ D  ++ R+  T+     
Sbjct: 160 GYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELP 219

Query: 68  DTW 70
           D++
Sbjct: 220 DSF 222


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 28.8 bits (64), Expect = 0.24
 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRI 58
           +MAPE++     YG  +D+W++G ++ E++   P    +S +  + R+
Sbjct: 183 WMAPEVI-SRTPYGTEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRL 229


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 28.8 bits (64), Expect = 0.27
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTL 62
           +MAPEL+  +R+ YG  +D+W++G ++ E++   P    E  L  +  I   L
Sbjct: 182 WMAPELI--SRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNL 232


>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR2 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. In
           addition, NDR2 plays a role in regulating neuronal
           growth and differentiation, as well as in facilitating
           neurite outgrowth. It is also implicated in fear
           conditioning as it contributes to the coupling of
           neuronal morphological changes with fear-memory
           consolidation. NDR2 is also referred to as STK38-like.
          Length = 360

 Score = 28.5 bits (63), Expect = 0.39
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 14/79 (17%)

Query: 2   QNWKKVRKA----------FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD 51
           + WKK R+           ++APE+ F    Y    D W++G I+ E+L+  P    E+ 
Sbjct: 183 ETWKKNRRQLAYSTVGTPDYIAPEV-FMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETP 241

Query: 52  LDQLTRIF---QTLGTPSE 67
            +   ++    +TL  P E
Sbjct: 242 QETYRKVMNWKETLVFPPE 260


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 11.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 11 (Nek11)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek11 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek11 is involved, through direct
           phosphorylation, in regulating the degradation of Cdc25A
           (Cell Division Cycle 25 homolog A), which plays a role
           in cell cycle progression and in activating cyclin
           dependent kinases. Nek11 is activated by CHK1
           (CHeckpoint Kinase 1) and may be involved in the G2/M
           checkpoint. Nek11 may also play a role in the S-phase
           checkpoint as well as in DNA replication and genotoxic
           stress responses.
          Length = 260

 Score = 28.0 bits (62), Expect = 0.49
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPS-EDT 69
           +M+PE L   + Y    D+W++GCI+ E+   A    G++ L  + RI +   TPS  +T
Sbjct: 171 YMSPEAL-KHQGYDSKSDIWSLGCILYEMCCLAHAFEGQNFLSVVLRIVEG-PTPSLPET 228

Query: 70  WP 71
           + 
Sbjct: 229 YS 230


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 6.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek6 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek6 is required
           for the transition from metaphase to anaphase. It also
           plays important roles in mitotic spindle formation and
           cytokinesis.  Activated by Nek9 during mitosis, Nek6
           phosphorylates Eg5, a kinesin that is important for
           spindle bipolarity. Nek6 localizes to spindle
           microtubules during metaphase and anaphase, and to the
           midbody during cytokinesis.
          Length = 267

 Score = 27.7 bits (61), Expect = 0.55
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICEL-LLKAPFLPGESDLDQL 55
           +M+PE +     Y    D+W++GC++ E+  L++PF   + +L  L
Sbjct: 172 YMSPERIH-ENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSL 216


>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR1 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. NDR1 is
           highly expressed in thymus, muscle, lung and spleen. It
           is not an essential protein because mice deficient of
           NDR1 remain viable and fertile. However, these mice
           develop T-cell lymphomas and appear to be hypersenstive
           to carcinogenic treatment. NDR1 appears to act as a
           tumor suppressor. NDR1 is also called STK38.
          Length = 363

 Score = 27.7 bits (61), Expect = 0.62
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 14/79 (17%)

Query: 2   QNWKKVRKA----------FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESD 51
           + WK+ R+           ++APE+ F    Y    D W++G I+ E+L+  P    E+ 
Sbjct: 183 ETWKRNRRQLAFSTVGTPDYIAPEV-FMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETP 241

Query: 52  LDQLTRIF---QTLGTPSE 67
            +   ++    +TL  P E
Sbjct: 242 QETYKKVMNWKETLIFPPE 260


>gnl|CDD|227487 COG5158, SEC1, Proteins involved in synaptic transmission and
           general secretion, Sec1 family [Intracellular
           trafficking and secretion].
          Length = 582

 Score = 27.8 bits (62), Expect = 0.62
 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%)

Query: 45  FLPGESDLDQL--TRIFQTLGTPSEDTWPTAGVKGLFSLIR 83
           F   ESDL  L     F     PS        V GLFSL  
Sbjct: 133 FFVLESDLFSLNLPESFLESSLPSTTEALIKIVNGLFSLCV 173


>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase.  Serine/Threonine Kinases
           (STKs), Rho-associated coiled-coil containing protein
           kinase (ROCK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The ROCK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. ROCK is also referred to as Rho-associated
           kinase or simply as Rho kinase. It contains an
           N-terminal extension, a catalytic kinase domain, and a
           long C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain. It is activated via interaction with Rho GTPases
           and is involved in many cellular functions including
           contraction, adhesion, migration, motility,
           proliferation, and apoptosis. The ROCK subfamily
           consists of two isoforms, ROCK1 and ROCK2, which may be
           functionally redundant in some systems, but exhibit
           different tissue distributions. Both isoforms are
           ubiquitously expressed in most tissues, but ROCK2 is
           more prominent in brain and skeletal muscle while ROCK1
           is more pronounced in the liver, testes, and kidney.
           Studies in knockout mice result in different phenotypes,
           suggesting that the two isoforms do not compensate for
           each other during embryonic development.
          Length = 370

 Score = 27.8 bits (62), Expect = 0.63
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 11  FMAPELLF---GARMYGVGIDMWAVGCIICELLL-KAPFL 46
           +++PE+L    G   YG   D W+VG  + E+L+   PF 
Sbjct: 209 YISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFY 248


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 1.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek1 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek1 is
           associated with centrosomes throughout the cell cycle.
           It is involved in the formation of primary cilium and in
           the maintenance of centrosomes. It cycles through the
           nucleus and may be capable of relaying signals between
           the cilium and the nucleus. Nek1 is implicated in the
           development of polycystic kidney disease, which is
           characterized by benign polycystic tumors formed by
           abnormal overgrowth of renal epithelial cells. It
           appears also to be involved in DNA damage response, and
           may be important for both correct DNA damage checkpoint
           activation and DNA repair.
          Length = 256

 Score = 27.5 bits (61), Expect = 0.72
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL-LKAPFLPG 48
           +++PE+    R Y    D+WA+GC++ E+  LK  F  G
Sbjct: 167 YLSPEIC-ENRPYNNKSDIWALGCVLYEMCTLKHAFEAG 204


>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
           Serine/Threonine Kinase, 70 kDa ribosomal protein S6
           kinase.  Serine/Threonine Kinases (STKs), 70 kDa
           ribosomal protein S6 kinase (p70S6K) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The p70S6K subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. p70S6K (or S6K)
           contains only one catalytic kinase domain, unlike p90
           ribosomal S6 kinases (RSKs). It acts as a downstream
           effector of the STK mTOR (mammalian Target of Rapamycin)
           and plays a role in the regulation of the translation
           machinery during protein synthesis. p70S6K also plays a
           pivotal role in regulating cell size and glucose
           homeostasis. Its targets include S6, the translation
           initiation factor eIF3, and the insulin receptor
           substrate IRS-1, among others. Mammals contain two
           isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta).
          Length = 323

 Score = 27.5 bits (61), Expect = 0.73
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGES 50
           +MAPE+L  +  +G  +D W++G ++ ++L  AP    E+
Sbjct: 166 YMAPEILMRSG-HGKAVDWWSLGALMYDMLTGAPPFTAEN 204


>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase 1.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, MSK1,
           N-terminal catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MSK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MSKs contain an N-terminal kinase domain (NTD)
           from the AGC family and a C-terminal kinase domain (CTD)
           from the CAMK family, similar to 90 kDa ribosomal
           protein S6 kinases (RSKs). MSKs are activated by two
           major signaling cascades, the Ras-MAPK and p38 stress
           kinase pathways, which trigger phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) of NTD,
           which facilitates the phosphorylation of the A-loop and
           activates the NTD, which in turn phosphorylates
           downstream targets. MSK1 plays a role in the regulation
           of translational control and transcriptional activation.
           It phosphorylates the transcription factors, CREB and
           NFkappaB. It also phosphorylates the nucleosomal
           proteins H3 and HMG-14. Increased phosphorylation of
           MEK1 is associated with the development of cerebral
           ischemic/hypoxic preconditioning.
          Length = 290

 Score = 27.3 bits (60), Expect = 0.90
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 11  FMAPELLFGARM-YGVGIDMWAVGCIICELLLKA-PF 45
           +MAP+++ G    +   +D W++G ++ ELL  A PF
Sbjct: 172 YMAPDIVRGGDGGHDKAVDWWSMGVLMYELLTGASPF 208


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 3.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek3 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek3 is primarily
           localized in the cytoplasm and shows no cell
           cycle-dependent changes in its activity. It is present
           in the axons of neurons and affects morphogenesis and
           polarity through its regulation of microtubule
           acetylation. Nek3 modulates the signaling of the
           prolactin receptor through its activation of Vav2 and
           contributes to prolactin-mediated motility of breast
           cancer cells.
          Length = 255

 Score = 27.2 bits (60), Expect = 0.93
 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 1/19 (5%)

Query: 28  DMWAVGCIICEL-LLKAPF 45
           D+W++GCI+ EL  LK PF
Sbjct: 182 DIWSLGCILYELCTLKHPF 200


>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
           subunit; Provisional.
          Length = 340

 Score = 27.3 bits (60), Expect = 0.95
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APE+L     +G   D W +G  I E+L+  P
Sbjct: 194 YIAPEILLNVG-HGKAADWWTLGIFIYEILVGCP 226


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 27.1 bits (60), Expect = 1.1
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           +++PEL    + Y    D+WA+G ++ E    K PF
Sbjct: 167 YLSPELC-EDKPYNEKSDVWALGVVLYECCTGKHPF 201


>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
           Serine/Threonine Kinase, beta-adrenergic receptor
           kinase.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily,
           beta-adrenergic receptor kinase (beta-ARK) group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. The beta-ARK
           group is composed of GRK2, GRK3, and similar proteins.
           GRK2 and GRK3 are both widely expressed in many tissues,
           although GRK2 is present at higher levels. They contain
           an N-terminal RGS homology (RH) domain, a central
           catalytic domain, and C-terminal pleckstrin homology
           (PH) domain that mediates PIP2 and G protein
           betagamma-subunit translocation to the membrane. GRK2
           (also called beta-ARK or beta-ARK1) is important in
           regulating several cardiac receptor responses. It plays
           a role in cardiac development and in hypertension.
           Deletion of GRK2 in mice results in embryonic lethality,
           caused by hypoplasia of the ventricular myocardium. GRK2
           also plays important roles in the liver (as a regulator
           of portal blood pressure), in immune cells, and in the
           nervous system. Altered GRK2 expression has been
           reported in several disorders including major
           depression, schizophrenia, bipolar disorder, and
           Parkinsonism.
          Length = 278

 Score = 26.8 bits (59), Expect = 1.2
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFLPGES-DLDQLTRIFQTLGTPSED 68
           +MAPE+L     Y    D +++GC++ +LL   +PF   ++ D  ++ R+  T+      
Sbjct: 161 YMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAV---- 216

Query: 69  TWPTAGVKGLFSLIR 83
             P +    L SL+ 
Sbjct: 217 ELPDSFSPELRSLLE 231


>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional.
          Length = 357

 Score = 26.8 bits (59), Expect = 1.3
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 11/66 (16%)

Query: 13  APELLFGARMYGVGIDMWAVGCIICELLL----------KAPFLPGESDLDQLTRIFQTL 62
           APE+L   + Y    D+W+ G ++ E+L             P    +S    L +I  TL
Sbjct: 224 APEVLARDK-YNSKADIWSAGIVLFEMLAYPSTIFEDPPSTPEEYVKSCHSHLLKIISTL 282

Query: 63  GTPSED 68
               E+
Sbjct: 283 KVHPEE 288


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 1.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           Inactivation of LATS1 in mice results in the development
           of various tumors, including sarcomas and ovarian
           cancer. Promoter methylation, loss of heterozygosity,
           and missense mutations targeting the LATS1 gene have
           also been found in human sarcomas and ovarian cancers.
           In addition, decreased expression of LATS1 is associated
           with an aggressive phenotype and poor prognosis. LATS1
           induces G2 arrest and promotes cytokinesis. It may be a
           component of the mitotic exit network in higher
           eukaryotes.
          Length = 382

 Score = 26.5 bits (58), Expect = 1.9
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPFL 46
           ++APE+L     Y    D W+VG I+ E+L+ + PFL
Sbjct: 214 YIAPEVLLRTG-YTQLCDWWSVGVILYEMLVGQPPFL 249


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B gamma.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-gamma is
           predominantly expressed in neuronal tissues. Mice
           deficient in PKB-gamma show a reduction in brain weight
           due to the decreases in cell size and cell number.
           PKB-gamma has also been shown to be upregulated in
           estrogen-deficient breast cancer cells,
           androgen-independent prostate cancer cells, and primary
           ovarian tumors. It acts as a key mediator in the genesis
           of ovarian cancer.
          Length = 328

 Score = 26.2 bits (57), Expect = 2.1
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L     YG  +D W +G ++ E++  + PF
Sbjct: 161 YLAPEVL-EDNDYGRAVDWWGLGVVMYEMMCGRLPF 195


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 26.0 bits (58), Expect = 2.5
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL 40
           ++APE++   + YG  +D WA+G +I E+L
Sbjct: 164 YLAPEIILS-KGYGKAVDWWALGILIYEML 192


>gnl|CDD|176566 cd08629, PI-PLCc_delta1, Catalytic domain of metazoan
           phosphoinositide-specific phospholipase C-delta1.  This
           subfamily corresponds to the catalytic domain present in
           metazoan phosphoinositide-specific phospholipase C
           (PI-PLC, EC 3.1.4.11)-delta1 isozymes. PI-PLC is a
           signaling enzyme that hydrolyzes the membrane
           phospholipids phosphatidylinositol-4,5-bisphosphate
           (PIP2)  to generate two important second messengers in
           eukaryotic signal transduction cascades,  Inositol
           1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG).
           InsP3 triggers inflow of calcium from intracellular
           stores, while DAG, together with calcium, activates
           protein kinase C, which then phosphorylates other
           molecules, leading to altered cellular activity. Calcium
           is required for the catalysis. PLC-delta represents a
           class of mammalian PI-PLC that has an N-terminal
           pleckstrin homology (PH) domain, an array of EF hands, a
           PLC catalytic core domain, and a C-terminal C2 domain.
           This subfamily corresponds to the catalytic domain which
           is a TIM barrel with two highly conserved regions (X and
           Y) split by a highly degenerate linker sequence. There
           are three PI-PLC-delta isozymes (1,3 and 4).
           PI-PLC-delta1 is relatively well characterized. It is
           activated by high calcium levels generated by other
           PI-PLC family members, and therefore functions as a
           calcium amplifier within the cell. Unlike PI-PLC-delta
           4, PI-PLC-delta1 and 3 possess a putative nuclear export
           sequence (NES) located in the EF-hand domain, which may
           be responsible transporting PI-PLC-delta1and 3 from the
           cell nucleus. Experiments show PI-PLC-delta1 is
           essential for normal hair formation.
          Length = 258

 Score = 25.8 bits (56), Expect = 2.7
 Identities = 9/28 (32%), Positives = 13/28 (46%), Gaps = 2/28 (7%)

Query: 27  IDMWAVGCIICELLLKAPFLPGESDLDQ 54
           ++MW  GC I  L  + P    E D+  
Sbjct: 227 VEMWNGGCQIVALNFQTPGP--EMDVYL 252


>gnl|CDD|232982 TIGR00457, asnS, asparaginyl-tRNA synthetase.  In a multiple
           sequence alignment of representative asparaginyl-tRNA
           synthetases (asnS), archaeal/eukaryotic type
           aspartyl-tRNA synthetases (aspS_arch), and bacterial
           type aspartyl-tRNA synthetases (aspS_bact), there is a
           striking similarity between asnS and aspS_arch in gap
           pattern and in sequence, and a striking divergence of
           aspS_bact. Consequently, a separate model was built for
           each of the three groups. This model, asnS, represents
           asparaginyl-tRNA synthetases from the three domains of
           life. Some species lack this enzyme and charge tRNA(asn)
           by misacylation with Asp, followed by transamidation of
           Asp to Asn [Protein synthesis, tRNA aminoacylation].
          Length = 453

 Score = 25.8 bits (57), Expect = 2.9
 Identities = 6/22 (27%), Positives = 11/22 (50%)

Query: 49  ESDLDQLTRIFQTLGTPSEDTW 70
           E DLD+L    + +G  ++   
Sbjct: 384 EDDLDKLENRMKEMGLDTDALN 405


>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B alpha.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, alpha (or Akt1) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-alpha is
           predominantly expressed in endothelial cells. It is
           critical for the regulation of angiogenesis and the
           maintenance of vascular integrity. It also plays a role
           in adipocyte differentiation. Mice deficient in
           PKB-alpha exhibit perinatal morbidity, growth
           retardation, reduction in body weight accompanied by
           reduced sizes of multiple organs, and enhanced apoptosis
           in some cell types. PKB-alpha activity has been reported
           to be frequently elevated in breast and prostate
           cancers. In some cancer cells, PKB-alpha may act as a
           suppressor of metastasis.
          Length = 325

 Score = 25.8 bits (56), Expect = 2.9
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L     YG  +D W +G ++ E++  + PF
Sbjct: 162 YLAPEVL-EDNDYGRAVDWWGLGVVMYEMMCGRLPF 196


>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 1.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
           expressed and is under transcriptional control of
           numerous stimuli including cell stress (cell shrinkage),
           serum, hormones (gluco- and mineralocorticoids),
           gonadotropins, growth factors, interleukin-6, and other
           cytokines. It plays roles in sodium retention and
           potassium elimination in the kidney, nutrient transport,
           salt sensitivity, memory consolidation, and cardiac
           repolarization. A common SGK1 variant is associated with
           increased blood pressure and body weight. SGK1 may also
           contribute to tumor growth, neurodegeneration, fibrosing
           disease, and ischemia.
          Length = 325

 Score = 25.7 bits (56), Expect = 3.1
 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APE+L   + Y   +D W +G ++ E+L   P
Sbjct: 162 YLAPEVLH-KQPYDRTVDWWCLGAVLYEMLYGLP 194


>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B beta.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-beta is the
           predominant PKB isoform expressed in insulin-responsive
           tissues. It plays a critical role in the regulation of
           glucose homeostasis. It is also implicated in muscle
           cell differentiation. Mice deficient in PKB-beta display
           normal growth weights but exhibit severe insulin
           resistance and diabetes, accompanied by lipoatrophy and
           B-cell failure.
          Length = 323

 Score = 25.7 bits (56), Expect = 3.1
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L     YG  +D W +G ++ E++  + PF
Sbjct: 161 YLAPEVL-EDNDYGRAVDWWGLGVVMYEMMCGRLPF 195


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 25.8 bits (56), Expect = 3.1
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 11  FMAPELLFGAR--MYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQ 60
           +MAPE++       Y   +D+W++G    EL  + P L   + +  L  I Q
Sbjct: 183 WMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQ 234


>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
           adapter protein.  Protein Kinase family, STE20-related
           kinase adapter protein (STRAD) subfamily, pseudokinase
           domain. The STRAD subfamily is part of a larger
           superfamily that includes the catalytic domains of
           serine/threonine kinases (STKs), protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           pseudokinase domain shows similarity to protein kinases
           but lacks crucial residues for catalytic activity. STRAD
           forms a complex with the scaffolding protein MO25, and
           the STK, LKB1, resulting in the activation of the
           kinase. In the complex, LKB1 phosphorylates and
           activates adenosine monophosphate-activated protein
           kinases (AMPKs), which regulate cell energy metabolism
           and cell polarity. LKB1 is a tumor suppressor linked to
           the rare inherited disease, Peutz-Jeghers syndrome,
           which is characterized by a predisposition to benign
           polyps and hyperpigmentation of the buccal mucosa. There
           are two forms of STRAD, alpha and beta, that complex
           with LKB1 and MO25. The structure of STRAD-alpha is
           available and shows that this protein binds ATP, has an
           ordered activation loop, and adopts a closed
           conformation typical of fully active protein kinases. It
           does not possess activity due to nonconservative
           substitutions of essential catalytic residues. ATP
           binding enhances the affinity of STRAD for MO25.  The
           conformation of STRAD-alpha stabilized through ATP and
           MO25 may be needed to activate LKB1.
          Length = 314

 Score = 25.8 bits (57), Expect = 3.4
 Identities = 11/39 (28%), Positives = 18/39 (46%), Gaps = 8/39 (20%)

Query: 2   QNWKKVRKAFMAPELLF-GARMYGVGIDMWAVGCIICEL 39
             W       ++PE+L    + Y    D+++VG   CEL
Sbjct: 172 LPW-------LSPEVLQQNLQGYNEKSDIYSVGITACEL 203


>gnl|CDD|153281 cd07597, BAR_SNX8, The Bin/Amphiphysin/Rvs (BAR) domain of
          Sorting Nexin 8.  BAR domains are dimerization, lipid
          binding and curvature sensing modules found in many
          different proteins with diverse functions. Sorting
          nexins (SNXs) are Phox homology (PX) domain containing
          proteins that are involved in regulating membrane
          traffic and protein sorting in the endosomal system.
          SNXs differ from each other in their lipid-binding
          specificity, subcellular localization and specific
          function in the endocytic pathway. A subset of SNXs
          also contain BAR domains. The PX-BAR structural unit
          determines the specific membrane targeting of SNXs.
          SNX8 and the yeast counterpart Mvp1p are involved in
          sorting and delivery of late-Golgi proteins, such as
          carboxypeptidase Y, to vacuoles. BAR domains form
          dimers that bind to membranes, induce membrane bending
          and curvature, and may also be involved in
          protein-protein interactions.
          Length = 246

 Score = 25.3 bits (56), Expect = 4.4
 Identities = 9/36 (25%), Positives = 16/36 (44%)

Query: 50 SDLDQLTRIFQTLGTPSEDTWPTAGVKGLFSLIRAG 85
          +D  +  R+  +LG  +   +P AG    +  I  G
Sbjct: 57 ADRAEFARLLNSLGELTARLYPWAGDSDTWGDINEG 92


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
           Phototropin-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Phototropin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           phototropin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Included in this subfamily
           are plant phototropins and predominantly uncharacterized
           fungal STKs whose catalytic domains resemble the
           phototropin kinase domain. One protein from Neurospora
           crassa is called nrc-2. Phototropins are blue-light
           receptors that control responses such as phototropism,
           stromatal opening, and chloroplast movement in order to
           optimize the photosynthetic efficiency of plants. They
           are light-activated STKs that contain an N-terminal
           photosensory domain and a C-terminal catalytic domain.
           The N-terminal domain contains two LOV (Light, Oxygen or
           Voltage) domains that binds FMN. Photoexcitation of the
           LOV domains results in autophosphorylation at multiple
           sites and activation of the catalytic domain. Neurospora
           crassa nrc-2 plays a role in growth and development by
           controlling entry into the conidiation program.
          Length = 316

 Score = 25.3 bits (56), Expect = 4.5
 Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELL 40
           ++APE++ G   +G  +D W +G ++ E+L
Sbjct: 198 YIAPEVISGDG-HGSAVDWWTLGILLYEML 226


>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 2.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK2 was the first identified target of
           activated RhoA, and was found to play a role in stress
           fiber and focal adhesion formation. It is prominently
           expressed in the brain, heart, and skeletal muscles. It
           is implicated in vascular and neurological disorders,
           such as hypertension and vasospasm of the coronary and
           cerebral arteries. ROCK2 is also activated by caspase-2
           cleavage, resulting in thrombin-induced microparticle
           generation in response to cell activation. Mice
           deficient in ROCK2 show intrauterine growth retardation
           and embryonic lethality because of placental
           dysfunction.
          Length = 370

 Score = 25.0 bits (54), Expect = 5.6
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 11  FMAPELLF---GARMYGVGIDMWAVGCIICELLL-KAPF 45
           +++PE+L    G   YG   D W+VG  + E+L+   PF
Sbjct: 209 YISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPF 247


>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 1.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK1 is preferentially expressed in the liver,
           lung, spleen, testes, and kidney. It mediates signaling
           from Rho to the actin cytoskeleton. It is implicated in
           the development of cardiac fibrosis, cardiomyocyte
           apoptosis, and hyperglycemia. Mice deficient with ROCK1
           display eyelids open at birth (EOB) and omphalocele
           phenotypes due to the disorganization of actin filaments
           in the eyelids and the umbilical ring.
          Length = 371

 Score = 25.0 bits (54), Expect = 5.9
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 11  FMAPELLF---GARMYGVGIDMWAVGCIICELLL-KAPF 45
           +++PE+L    G   YG   D W+VG  + E+L+   PF
Sbjct: 209 YISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPF 247


>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase B.  Serine/Threonine Kinases
           (STKs), Protein Kinase B (PKB) or Akt subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). There are
           three PKB isoforms from different genes, PKB-alpha (or
           Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. It is activated
           downstream of PI3K and plays important roles in diverse
           cellular functions including cell survival, growth,
           proliferation, angiogenesis, motility, and migration.
           PKB also has a central role in a variety of human
           cancers, having been implicated in tumor initiation,
           progression, and metastasis.
          Length = 323

 Score = 24.8 bits (54), Expect = 6.6
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL-KAPF 45
           ++APE+L     YG  +D W +G ++ E++  + PF
Sbjct: 161 YLAPEVL-EDNDYGRAVDWWGLGVVMYEMMCGRLPF 195


>gnl|CDD|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain
           containing proteins like Saccharomyces cerevisiae
           aminopeptidase Y (ScAPY). This group contains various PA
           domain-containing proteins similar to the S. cerevisiae
           APY, including Trichophyton rubrum leucine
           aminopeptidase 1(LAP1). Proteins in this group belong to
           the peptidase M28 family. ScAPY hydrolyzes amino
           acid-4-methylcoumaryl-7-amides (MCAs). ScAPY more
           rapidly hydrolyzes dipeptidyl-MCAs. Hydrolysis of amino
           acid-MCAs or dipeptides is stimulated by Co2+ while  the
           hydrolysis of dipeptidyl-MCAs, tripeptides, and longer
           peptides is inhibited by Co2+. ScAPY is vacuolar and  is
           activated by proteolytic processing. LAP1 is a secreted
           leucine aminopeptidase. The significance of the PA
           domain to these proteins has not been ascertained. It
           may be a protein-protein interaction domain. At
           peptidase active sites, the PA domain may participate in
           substrate binding and/or promoting conformational
           changes, which influence the stability and accessibility
           of the site to substrate.
          Length = 122

 Score = 24.5 bits (54), Expect = 7.2
 Identities = 8/19 (42%), Positives = 9/19 (47%)

Query: 61  TLGTPSEDTWPTAGVKGLF 79
           TLG PS    PT G+    
Sbjct: 86  TLGEPSGPYVPTVGISQED 104


>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase.
          Length = 412

 Score = 24.4 bits (53), Expect = 8.2
 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 6/53 (11%)

Query: 6   KVRKAFMAPELLFG------ARMYGVGIDMWAVGCIICELLLKAPFLPGESDL 52
           K RK F AP   F        RM G    M+ VG  +C+L       PG + L
Sbjct: 285 KERKQFGAPLAAFQINQEKLVRMLGNIQAMFLVGWRLCKLYESGKMTPGHASL 337


>gnl|CDD|146789 pfam04337, DUF480, Protein of unknown function, DUF480.  This
           family consists of several proteins of uncharacterized
           function.
          Length = 148

 Score = 24.4 bits (54), Expect = 8.6
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 35  IICELLLKAPFLPGE 49
           ++C LLL+ P  PGE
Sbjct: 93  LLCLLLLRGPQTPGE 107


>gnl|CDD|214592 smart00268, ACTIN, Actin.  ACTIN subfamily of
           ACTIN/mreB/sugarkinase/Hsp70 superfamily.
          Length = 373

 Score = 24.5 bits (54), Expect = 9.2
 Identities = 9/31 (29%), Positives = 13/31 (41%), Gaps = 6/31 (19%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLL 41
           F  PE+LF   + G+          I EL+ 
Sbjct: 253 FRIPEILFSPELIGLE------QKGIHELVY 277


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
           Provisional.
          Length = 329

 Score = 24.4 bits (53), Expect = 9.9
 Identities = 9/34 (26%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 11  FMAPELLFGARMYGVGIDMWAVGCIICELLLKAP 44
           ++APE++  ++ +G  +D W +G ++ E +   P
Sbjct: 181 YLAPEVI-QSKGHGKAVDWWTMGVLLYEFIAGYP 213


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.325    0.142    0.460 

Gapped
Lambda     K      H
   0.267   0.0756    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,454,334
Number of extensions: 354381
Number of successful extensions: 581
Number of sequences better than 10.0: 1
Number of HSP's gapped: 567
Number of HSP's successfully gapped: 182
Length of query: 85
Length of database: 10,937,602
Length adjustment: 53
Effective length of query: 32
Effective length of database: 8,586,840
Effective search space: 274778880
Effective search space used: 274778880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.1 bits)