Query         psy13994
Match_columns 97
No_of_seqs    118 out of 2199
Neff          11.6
Searched_HMMs 46136
Date          Fri Aug 16 16:48:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13994.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13994hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 2.6E-29 5.6E-34  139.6   4.4   97    1-97    135-239 (279)
  2 KOG2462|consensus               99.9 1.6E-26 3.5E-31  128.6   4.5   93    1-95    166-265 (279)
  3 KOG1074|consensus               99.9 1.5E-23 3.3E-28  130.3   1.1   48    1-48    358-405 (958)
  4 KOG1074|consensus               99.9 3.4E-22 7.4E-27  124.4   3.5   48   50-97    884-931 (958)
  5 KOG3576|consensus               99.7 5.1E-18 1.1E-22   91.7   3.0   75   21-95    114-195 (267)
  6 KOG3623|consensus               99.7 1.1E-17 2.3E-22  103.9   2.2   94    2-95    216-331 (1007)
  7 KOG3623|consensus               99.7 1.4E-17   3E-22  103.4   2.6   70   24-93    894-970 (1007)
  8 KOG3608|consensus               99.6 8.9E-16 1.9E-20   89.0   6.6   96    2-97    185-316 (467)
  9 KOG3576|consensus               99.6 4.8E-16   1E-20   84.2   2.0   96    1-96    122-235 (267)
 10 KOG3608|consensus               99.5 8.6E-14 1.9E-18   80.9   6.1   95    1-95    268-374 (467)
 11 KOG3993|consensus               99.4 1.9E-13 4.1E-18   80.9   1.8   96    1-96    272-379 (500)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.3 8.9E-13 1.9E-17   50.0   1.7   26   60-85      1-26  (26)
 13 PHA00733 hypothetical protein   99.2 1.9E-11   4E-16   63.1   4.3   73   22-96     38-122 (128)
 14 PF13465 zf-H2C2_2:  Zinc-finge  99.2 7.6E-12 1.7E-16   47.4   2.1   26   11-36      1-26  (26)
 15 PHA02768 hypothetical protein;  99.2 1.5E-11 3.3E-16   53.9   1.7   38   51-90     11-48  (55)
 16 PLN03086 PRLI-interacting fact  99.0 8.4E-10 1.8E-14   68.6   5.9   86    2-94    459-561 (567)
 17 PHA02768 hypothetical protein;  99.0   2E-10 4.4E-15   50.3   1.4   35    2-38     11-45  (55)
 18 PHA00733 hypothetical protein   98.9 4.5E-09 9.6E-14   54.4   4.6   50   20-69     69-123 (128)
 19 PLN03086 PRLI-interacting fact  98.8 1.2E-08 2.6E-13   63.7   5.4   71   22-95    451-536 (567)
 20 PF00096 zf-C2H2:  Zinc finger,  98.8 2.6E-09 5.6E-14   39.2   1.2   23   74-96      1-23  (23)
 21 PHA00616 hypothetical protein   98.8 3.2E-09 6.9E-14   44.5   1.5   25   73-97      1-25  (44)
 22 COG5189 SFP1 Putative transcri  98.7 1.4E-09 3.1E-14   63.0  -0.4   71   22-94    347-419 (423)
 23 KOG3993|consensus               98.7 4.9E-09 1.1E-13   62.8   1.6   95    1-95    300-480 (500)
 24 PHA00732 hypothetical protein   98.7 1.5E-08 3.2E-13   48.1   2.2   22   24-45      1-22  (79)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.5 4.8E-08   1E-12   37.1   1.5   25   73-97      1-25  (27)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.5 5.3E-08 1.2E-12   35.7   1.5   24   74-97      1-24  (24)
 27 PF12756 zf-C2H2_2:  C2H2 type   98.5 6.2E-08 1.3E-12   47.9   2.0   70   26-96      1-73  (100)
 28 PF00096 zf-C2H2:  Zinc finger,  98.4 2.3E-07   5E-12   33.8   1.9   22   25-46      1-22  (23)
 29 smart00355 ZnF_C2H2 zinc finge  98.3 8.3E-07 1.8E-11   32.9   1.8   23   74-96      1-23  (26)
 30 PHA00616 hypothetical protein   98.2 6.2E-07 1.3E-11   37.7   1.4   34   24-78      1-34  (44)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.5E-06 3.2E-11   31.7   2.0   23   25-47      1-23  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   98.2   1E-06 2.2E-11   33.3   1.3   25   24-48      1-25  (27)
 33 PHA00732 hypothetical protein   98.1 1.6E-06 3.5E-11   41.3   1.9   42    1-48      6-48  (79)
 34 PF12874 zf-met:  Zinc-finger o  97.9 5.4E-06 1.2E-10   30.7   1.1   23   74-96      1-23  (25)
 35 smart00355 ZnF_C2H2 zinc finge  97.7 4.9E-05 1.1E-09   27.9   2.0   23   25-47      1-23  (26)
 36 PF12874 zf-met:  Zinc-finger o  97.6 3.1E-05 6.7E-10   28.6   1.2   22   25-46      1-22  (25)
 37 PF09237 GAGA:  GAGA factor;  I  97.6 5.4E-05 1.2E-09   32.6   1.9   29   68-96     19-47  (54)
 38 PF12171 zf-C2H2_jaz:  Zinc-fin  97.6 1.6E-05 3.5E-10   30.0   0.1   22   74-95      2-23  (27)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.5 5.1E-05 1.1E-09   27.7   1.3   22   74-96      1-22  (24)
 40 PF05605 zf-Di19:  Drought indu  97.5 0.00029 6.4E-09   31.1   3.8   50   24-96      2-52  (54)
 41 PF12756 zf-C2H2_2:  C2H2 type   97.5  0.0001 2.2E-09   36.3   2.5   20    1-20      4-23  (100)
 42 PF05605 zf-Di19:  Drought indu  97.4 0.00044 9.4E-09   30.5   3.6   44    1-47      7-52  (54)
 43 PF09237 GAGA:  GAGA factor;  I  97.2  0.0004 8.7E-09   30.0   2.3   30   19-48     19-48  (54)
 44 COG5189 SFP1 Putative transcri  97.1 0.00012 2.7E-09   43.2   0.1   44    2-45    357-419 (423)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  97.1 9.2E-05   2E-09   27.9  -0.3   22   25-46      2-23  (27)
 46 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00068 1.5E-08   24.6   1.6   22   25-47      1-22  (24)
 47 smart00451 ZnF_U1 U1-like zinc  96.9 0.00078 1.7E-08   26.7   1.5   23   73-95      3-25  (35)
 48 PF13913 zf-C2HC_2:  zinc-finge  96.8  0.0011 2.5E-08   24.5   1.6   21   74-95      3-23  (25)
 49 PRK04860 hypothetical protein;  96.7  0.0013 2.7E-08   35.6   1.7   30   57-86    127-156 (160)
 50 smart00451 ZnF_U1 U1-like zinc  96.4  0.0027 5.8E-08   25.1   1.6   23   24-46      3-25  (35)
 51 PRK04860 hypothetical protein;  96.4  0.0017 3.7E-08   35.1   1.2   30    8-37    127-156 (160)
 52 COG5048 FOG: Zn-finger [Genera  96.3 0.00019 4.2E-09   43.6  -3.0   47    2-48    295-347 (467)
 53 KOG1146|consensus               96.2  0.0012 2.6E-08   45.6  -0.2   75   19-95    460-540 (1406)
 54 COG4049 Uncharacterized protei  95.0   0.015 3.2E-07   25.7   1.2   27   68-94     12-38  (65)
 55 cd00350 rubredoxin_like Rubred  94.7   0.017 3.8E-07   22.7   0.9   10   72-81     16-25  (33)
 56 KOG1146|consensus               94.7  0.0067 1.4E-07   42.3  -0.5   69   22-95   1282-1350(1406)
 57 KOG4173|consensus               94.6   0.036 7.9E-07   31.2   2.2   71   24-94     79-167 (253)
 58 PF02892 zf-BED:  BED zinc fing  94.1   0.044 9.6E-07   22.9   1.6   25   70-94     13-41  (45)
 59 KOG2231|consensus               93.5    0.15 3.2E-06   33.8   3.7   60   35-95    125-204 (669)
 60 COG1592 Rubrerythrin [Energy p  93.4   0.049 1.1E-06   29.7   1.3   13   68-80    144-156 (166)
 61 COG5048 FOG: Zn-finger [Genera  92.8   0.012 2.7E-07   35.9  -1.7   47   50-96    294-346 (467)
 62 smart00614 ZnF_BED BED zinc fi  92.2   0.094   2E-06   22.6   1.2   23   74-96     19-47  (50)
 63 TIGR00622 ssl1 transcription f  91.5    0.22 4.7E-06   25.5   2.1   73   22-96     13-104 (112)
 64 smart00734 ZnF_Rad18 Rad18-lik  90.9    0.23 4.9E-06   18.4   1.4   19   75-94      3-21  (26)
 65 PHA00626 hypothetical protein   90.3    0.12 2.6E-06   22.9   0.5   16   71-86     21-36  (59)
 66 KOG2893|consensus               90.2   0.086 1.9E-06   30.5  -0.0   19   27-45     13-31  (341)
 67 KOG4173|consensus               90.2    0.31 6.7E-06   27.7   2.1   60    4-66     89-167 (253)
 68 KOG2785|consensus               90.1    0.39 8.5E-06   29.7   2.7   71   25-95      4-90  (390)
 69 KOG2893|consensus               90.0    0.07 1.5E-06   30.8  -0.5   39    1-43     15-53  (341)
 70 KOG0717|consensus               87.9    0.31 6.7E-06   31.0   1.2   22   74-95    293-314 (508)
 71 KOG3408|consensus               87.9    0.47   1E-05   24.6   1.7   26   70-95     54-79  (129)
 72 PF04959 ARS2:  Arsenite-resist  87.3    0.52 1.1E-05   27.0   1.8   27   22-48     75-101 (214)
 73 PF07754 DUF1610:  Domain of un  87.2    0.21 4.5E-06   18.2   0.2   10   72-81     15-24  (24)
 74 PF10571 UPF0547:  Uncharacteri  86.1     0.3 6.5E-06   18.1   0.3   10   75-84     16-25  (26)
 75 KOG4167|consensus               85.8    0.22 4.7E-06   33.4  -0.2   25   73-97    792-816 (907)
 76 smart00834 CxxC_CXXC_SSSS Puta  85.4    0.27 5.9E-06   19.9   0.1   11   74-84      6-16  (41)
 77 COG5152 Uncharacterized conser  85.0    0.73 1.6E-05   26.1   1.6   56   22-92    194-253 (259)
 78 PF05290 Baculo_IE-1:  Baculovi  84.9    0.54 1.2E-05   24.8   1.0   61   19-88     75-136 (140)
 79 KOG2482|consensus               84.3    0.64 1.4E-05   28.5   1.3   35   59-95    183-217 (423)
 80 KOG4167|consensus               84.2    0.25 5.3E-06   33.2  -0.5   25   24-48    792-816 (907)
 81 KOG2231|consensus               84.1     2.1 4.7E-05   28.8   3.6   65   26-94    184-260 (669)
 82 PF08790 zf-LYAR:  LYAR-type C2  83.8     0.1 2.2E-06   19.8  -1.4   11   74-84      1-11  (28)
 83 PF09723 Zn-ribbon_8:  Zinc rib  83.3    0.36 7.8E-06   20.0  -0.0   12   74-85      6-17  (42)
 84 PF09538 FYDLN_acid:  Protein o  83.2    0.76 1.7E-05   23.4   1.1   14   72-85     25-38  (108)
 85 PF15269 zf-C2H2_7:  Zinc-finge  83.2    0.84 1.8E-05   19.3   1.1   21   74-94     21-41  (54)
 86 COG5188 PRP9 Splicing factor 3  83.1     2.9 6.3E-05   26.0   3.6   27   66-92    367-394 (470)
 87 PF12013 DUF3505:  Protein of u  82.8       1 2.2E-05   22.8   1.5   23   74-96     81-107 (109)
 88 PF05443 ROS_MUCR:  ROS/MUCR tr  82.7    0.74 1.6E-05   24.3   1.0   23   71-96     70-92  (132)
 89 PF13451 zf-trcl:  Probable zin  82.6     0.4 8.7E-06   20.8   0.0   16   71-86      2-17  (49)
 90 KOG0978|consensus               82.5    0.62 1.3E-05   31.3   0.8   53   24-90    643-695 (698)
 91 KOG4124|consensus               81.8   0.097 2.1E-06   31.9  -2.7   68   22-91    347-416 (442)
 92 PF04959 ARS2:  Arsenite-resist  80.8    0.96 2.1E-05   26.0   1.1   26   70-95     74-99  (214)
 93 KOG2785|consensus               79.9     7.1 0.00015   24.5   4.5   72   22-94    164-241 (390)
 94 KOG2482|consensus               79.8     3.6 7.7E-05   25.5   3.2   25   24-48    195-219 (423)
 95 TIGR02605 CxxC_CxxC_SSSS putat  79.7    0.59 1.3E-05   20.1   0.0   12   74-85      6-17  (52)
 96 KOG2186|consensus               79.0     1.4 3.1E-05   25.9   1.4   28   63-92     20-47  (276)
 97 COG3677 Transposase and inacti  78.4    0.99 2.1E-05   23.7   0.6   16   70-85     50-65  (129)
 98 PF13878 zf-C2H2_3:  zinc-finge  77.2     2.3 4.9E-05   17.6   1.4   24   73-96     13-38  (41)
 99 COG1773 Rubredoxin [Energy pro  76.9    0.84 1.8E-05   20.3   0.1   12   73-84      3-14  (55)
100 PF01927 Mut7-C:  Mut7-C RNAse   76.4     1.5 3.2E-05   23.5   1.0   21   73-93    124-144 (147)
101 smart00154 ZnF_AN1 AN1-like Zi  75.6     1.1 2.5E-05   18.3   0.3   13   73-85     12-24  (39)
102 PF01428 zf-AN1:  AN1-like Zinc  74.8    0.75 1.6E-05   19.1  -0.3   14   72-85     12-25  (43)
103 KOG2636|consensus               74.4     2.7 5.8E-05   26.9   1.8   28   66-93    394-422 (497)
104 COG2888 Predicted Zn-ribbon RN  73.9     1.4 3.1E-05   19.8   0.4   11   71-81     48-58  (61)
105 cd00924 Cyt_c_Oxidase_Vb Cytoc  73.0     1.8   4E-05   21.6   0.7   19   18-37     74-92  (97)
106 PLN02294 cytochrome c oxidase   72.6     1.9 4.2E-05   23.8   0.8   16   22-37    139-154 (174)
107 PF07975 C1_4:  TFIIH C1-like d  72.3    0.74 1.6E-05   20.1  -0.6   26   71-96     19-44  (51)
108 KOG2071|consensus               70.9       3 6.5E-05   27.6   1.5   26   71-96    416-441 (579)
109 cd00729 rubredoxin_SM Rubredox  70.8     1.5 3.2E-05   17.3   0.1   12   73-84      2-13  (34)
110 PF09986 DUF2225:  Uncharacteri  70.6     1.9 4.1E-05   24.7   0.6   20   22-41      3-22  (214)
111 PF04780 DUF629:  Protein of un  70.4     3.4 7.3E-05   26.7   1.6   22   74-95     58-79  (466)
112 PF02891 zf-MIZ:  MIZ/SP-RING z  69.3     1.9 4.2E-05   18.6   0.3    9   73-81     41-49  (50)
113 PF13717 zinc_ribbon_4:  zinc-r  68.5     3.4 7.4E-05   16.5   0.9   12   72-83     24-35  (36)
114 PF04423 Rad50_zn_hook:  Rad50   68.5     4.5 9.8E-05   17.6   1.4   14   26-39     22-35  (54)
115 KOG2636|consensus               68.3     4.7  0.0001   25.9   1.9   30   17-46    394-424 (497)
116 PRK14890 putative Zn-ribbon RN  68.2     2.3 5.1E-05   19.2   0.5   11   71-81     46-56  (59)
117 KOG0717|consensus               68.1     3.6 7.7E-05   26.6   1.3   23   25-47    293-315 (508)
118 KOG1813|consensus               67.8     4.4 9.5E-05   24.6   1.6   59   21-94    238-300 (313)
119 TIGR02300 FYDLN_acid conserved  67.7     3.9 8.3E-05   21.6   1.2   10   25-34     10-19  (129)
120 KOG2593|consensus               67.3     5.3 0.00011   25.5   1.9   21   69-89    124-144 (436)
121 PTZ00448 hypothetical protein;  66.3     4.9 0.00011   25.1   1.7   23   73-95    314-336 (373)
122 COG4957 Predicted transcriptio  66.2     3.3 7.1E-05   22.0   0.8   20   74-96     77-96  (148)
123 cd00730 rubredoxin Rubredoxin;  65.9     2.2 4.8E-05   18.5   0.2   11   74-84      2-12  (50)
124 KOG1842|consensus               65.0     4.3 9.4E-05   26.1   1.3   23   73-95     15-37  (505)
125 PF01286 XPA_N:  XPA protein N-  64.4     2.4 5.1E-05   16.9   0.1   13   75-87      5-17  (34)
126 PF10013 DUF2256:  Uncharacteri  64.1     2.6 5.6E-05   17.6   0.2   12   75-86     10-21  (42)
127 PRK00398 rpoP DNA-directed RNA  63.7     2.5 5.5E-05   17.7   0.1   12   73-84      3-14  (46)
128 PF00301 Rubredoxin:  Rubredoxi  63.7     2.1 4.5E-05   18.3  -0.1   11   74-84      2-12  (47)
129 PF04780 DUF629:  Protein of un  63.5     6.9 0.00015   25.4   2.0   25   24-48     57-81  (466)
130 PRK00464 nrdR transcriptional   63.4     2.2 4.9E-05   23.2  -0.1   14   73-86     28-41  (154)
131 PF12907 zf-met2:  Zinc-binding  63.1     6.8 0.00015   16.2   1.3   21   74-94      2-25  (40)
132 PLN03238 probable histone acet  60.6     7.7 0.00017   23.5   1.7   25   71-95     46-70  (290)
133 PF09845 DUF2072:  Zn-ribbon co  60.4     3.9 8.5E-05   21.6   0.5   27   24-53      1-27  (131)
134 PF08792 A2L_zn_ribbon:  A2L zi  59.2     3.6 7.8E-05   16.1   0.2   12   73-84     21-32  (33)
135 COG3357 Predicted transcriptio  59.2       4 8.6E-05   20.2   0.4   14   72-85     57-70  (97)
136 PF08209 Sgf11:  Sgf11 (transcr  59.1      10 0.00022   14.9   1.5   21   24-45      4-24  (33)
137 PF06220 zf-U1:  U1 zinc finger  58.0      12 0.00025   15.2   1.6   22   73-94      3-26  (38)
138 PTZ00043 cytochrome c oxidase   58.0     5.4 0.00012   23.2   0.8   18   21-38    178-195 (268)
139 COG5112 UFD2 U1-like Zn-finger  57.9     7.6 0.00017   19.8   1.2   24   72-95     54-77  (126)
140 KOG2807|consensus               57.6      15 0.00032   22.8   2.6   72   23-96    289-368 (378)
141 smart00531 TFIIE Transcription  56.0      15 0.00032   19.7   2.2   19   20-38     95-113 (147)
142 PF02176 zf-TRAF:  TRAF-type zi  55.8     3.8 8.3E-05   18.0   0.0   27   59-85     24-54  (60)
143 COG5236 Uncharacterized conser  55.4      37  0.0008   21.5   4.0   22   27-48    223-244 (493)
144 PF10276 zf-CHCC:  Zinc-finger   55.2     3.5 7.7E-05   17.0  -0.1   12   72-83     28-39  (40)
145 PLN00104 MYST -like histone ac  54.9     9.4  0.0002   24.7   1.5   25   71-95    196-220 (450)
146 PF14353 CpXC:  CpXC protein     54.8     4.5 9.8E-05   21.0   0.2   16   71-86     36-51  (128)
147 COG3364 Zn-ribbon containing p  54.7     6.3 0.00014   19.9   0.7   27   23-52      1-27  (112)
148 PF15227 zf-C3HC4_4:  zinc fing  54.6       3 6.5E-05   17.2  -0.4   28   50-79     15-42  (42)
149 PF01780 Ribosomal_L37ae:  Ribo  54.2     4.7  0.0001   19.9   0.2   11   72-82     34-44  (90)
150 PF01215 COX5B:  Cytochrome c o  54.0     4.7  0.0001   21.5   0.1   19   18-37    107-125 (136)
151 COG1656 Uncharacterized conser  54.0      11 0.00023   20.9   1.5   21   72-92    129-149 (165)
152 TIGR00373 conserved hypothetic  53.8      18 0.00038   19.8   2.3   23   18-40    103-125 (158)
153 KOG2747|consensus               53.8     8.8 0.00019   24.3   1.3   26   71-96    156-181 (396)
154 TIGR02098 MJ0042_CXXC MJ0042 f  53.5     4.8  0.0001   15.9   0.1   14   74-87      3-16  (38)
155 PF13824 zf-Mss51:  Zinc-finger  53.1     7.6 0.00017   17.3   0.7   16   69-84     10-25  (55)
156 COG1198 PriA Primosomal protei  52.7     1.7 3.6E-05   29.6  -1.9   46   25-82    436-484 (730)
157 PF06397 Desulfoferrod_N:  Desu  52.6     5.2 0.00011   16.1   0.2   12   72-83      5-16  (36)
158 PTZ00064 histone acetyltransfe  52.6      11 0.00025   24.8   1.6   26   70-95    277-302 (552)
159 PLN03239 histone acetyltransfe  51.9      11 0.00024   23.5   1.5   24   71-94    104-127 (351)
160 smart00659 RPOLCX RNA polymera  51.1     5.5 0.00012   16.8   0.1   13   73-85      2-14  (44)
161 PTZ00255 60S ribosomal protein  50.9     6.6 0.00014   19.4   0.4   11   72-82     35-45  (90)
162 PF05191 ADK_lid:  Adenylate ki  49.8     4.9 0.00011   16.1  -0.1   11   74-84      2-12  (36)
163 PLN02748 tRNA dimethylallyltra  49.4      13 0.00029   24.2   1.6   24   23-46    417-441 (468)
164 COG0068 HypF Hydrogenase matur  49.4     1.1 2.4E-05   30.2  -3.1   50   26-81    125-181 (750)
165 TIGR00280 L37a ribosomal prote  48.7     7.8 0.00017   19.2   0.4   10   73-82     35-44  (91)
166 PF04438 zf-HIT:  HIT zinc fing  48.6     6.8 0.00015   15.0   0.2   13   72-84     12-24  (30)
167 PHA02926 zinc finger-like prot  48.5      17 0.00036   21.4   1.8   73   13-85    159-231 (242)
168 PF04641 Rtf2:  Rtf2 RING-finge  48.1     6.5 0.00014   23.3   0.1   52   22-85    111-162 (260)
169 PF13719 zinc_ribbon_5:  zinc-r  47.8     9.2  0.0002   15.3   0.5   14   71-84     23-36  (37)
170 COG4530 Uncharacterized protei  47.6     9.6 0.00021   19.6   0.7   14   71-84     24-37  (129)
171 PF02748 PyrI_C:  Aspartate car  47.6     7.1 0.00015   17.1   0.2   18   69-86     31-48  (52)
172 COG4391 Uncharacterized protei  47.1     6.7 0.00015   17.9   0.1   13   73-85     48-60  (62)
173 KOG0402|consensus               46.2     6.4 0.00014   19.1  -0.1   10   73-82     36-45  (92)
174 PLN03208 E3 ubiquitin-protein   46.1      18 0.00038   20.7   1.6   54   23-85     17-80  (193)
175 PRK06266 transcription initiat  45.9      23  0.0005   19.8   2.0   20   20-39    113-132 (178)
176 TIGR03831 YgiT_finger YgiT-typ  45.9     7.9 0.00017   15.8   0.2   13   73-85     32-44  (46)
177 PF11931 DUF3449:  Domain of un  45.8     6.8 0.00015   22.3   0.0   25   68-92     96-121 (196)
178 PRK08222 hydrogenase 4 subunit  45.7      16 0.00034   20.5   1.4   20   71-90    112-131 (181)
179 PRK01343 zinc-binding protein;  44.3      13 0.00028   16.7   0.7   12   73-84      9-20  (57)
180 PRK03976 rpl37ae 50S ribosomal  44.2     9.6 0.00021   18.8   0.4   11   72-82     35-45  (90)
181 PF05129 Elf1:  Transcription e  44.1     9.8 0.00021   18.3   0.4   10   71-80     20-29  (81)
182 TIGR00244 transcriptional regu  43.5     8.8 0.00019   20.8   0.2   15   73-87     28-42  (147)
183 PF08271 TF_Zn_Ribbon:  TFIIB z  43.1      10 0.00022   15.6   0.3    9   74-82      1-9   (43)
184 KOG0320|consensus               43.0       7 0.00015   21.9  -0.2   48   24-84    131-178 (187)
185 COG2331 Uncharacterized protei  43.0     8.5 0.00018   18.4   0.1   12   73-84     12-23  (82)
186 PF03604 DNA_RNApol_7kD:  DNA d  42.9     8.8 0.00019   15.0   0.1   11   74-84      1-11  (32)
187 KOG1729|consensus               42.9      15 0.00031   22.4   1.0   57   23-83    167-224 (288)
188 TIGR03829 YokU_near_AblA uncha  42.6      24 0.00051   17.5   1.6   21   23-43     34-54  (89)
189 TIGR01206 lysW lysine biosynth  41.7      12 0.00026   16.6   0.4   13   25-37      3-15  (54)
190 PRK12387 formate hydrogenlyase  41.1      19 0.00041   20.0   1.3   19   71-89    112-130 (180)
191 PF01096 TFIIS_C:  Transcriptio  40.9     7.6 0.00016   15.7  -0.2   10   74-83     29-38  (39)
192 smart00504 Ubox Modified RING   40.5      36 0.00078   14.8   2.4   46   25-85      2-47  (63)
193 PF10083 DUF2321:  Uncharacteri  40.1      11 0.00025   20.6   0.3   18   22-39     66-83  (158)
194 PF14354 Lar_restr_allev:  Rest  40.1      15 0.00032   16.2   0.6    8   74-81      4-11  (61)
195 KOG4727|consensus               39.5      17 0.00036   20.4   0.9   21   73-93     75-95  (193)
196 COG1327 Predicted transcriptio  39.4      12 0.00025   20.5   0.3   15   73-87     28-42  (156)
197 COG5432 RAD18 RING-finger-cont  39.4      19 0.00042   22.0   1.2   44   25-83     26-69  (391)
198 PF00097 zf-C3HC4:  Zinc finger  39.3      30 0.00066   13.6   1.8    9   71-79     33-41  (41)
199 PF14787 zf-CCHC_5:  GAG-polypr  39.1     9.3  0.0002   15.4  -0.1   15   75-89      4-18  (36)
200 PRK09678 DNA-binding transcrip  38.9     5.6 0.00012   18.7  -0.8   15   71-85     25-41  (72)
201 smart00440 ZnF_C2C2 C2C2 Zinc   38.5      12 0.00026   15.3   0.2   11   74-84     29-39  (40)
202 TIGR00319 desulf_FeS4 desulfof  38.4      12 0.00026   14.4   0.2   12   72-83      6-17  (34)
203 COG1997 RPL43A Ribosomal prote  38.4      12 0.00025   18.4   0.1   14   72-85     52-65  (89)
204 PF14446 Prok-RING_1:  Prokaryo  38.4      11 0.00024   16.7   0.1   11   74-84      6-16  (54)
205 cd00974 DSRD Desulforedoxin (D  38.2      12 0.00027   14.4   0.2   12   72-83      3-14  (34)
206 PF14369 zf-RING_3:  zinc-finge  37.8      13 0.00027   14.8   0.2   10   75-84     23-32  (35)
207 COG4338 Uncharacterized protei  37.4     8.8 0.00019   16.5  -0.3   12   75-86     14-25  (54)
208 PF12230 PRP21_like_P:  Pre-mRN  37.3      11 0.00024   21.8   0.0   25   71-96    166-190 (229)
209 PF14690 zf-ISL3:  zinc-finger   37.2      17 0.00036   15.0   0.5    9   73-81      2-10  (47)
210 PF05766 NinG:  Bacteriophage L  37.0      11 0.00023   21.4  -0.1   16   22-37      4-19  (189)
211 KOG1994|consensus               36.9      19 0.00042   21.1   0.9   22   71-92    237-258 (268)
212 COG1996 RPC10 DNA-directed RNA  36.6     9.8 0.00021   16.5  -0.2   13   72-84      5-17  (49)
213 COG5027 SAS2 Histone acetyltra  36.1      24 0.00053   22.2   1.3   26   71-96    156-181 (395)
214 PF03107 C1_2:  C1 domain;  Int  36.0      20 0.00044   13.4   0.6    8   73-80     15-22  (30)
215 KOG3214|consensus               35.9      14 0.00031   18.6   0.2   15   25-39     48-62  (109)
216 PF08274 PhnA_Zn_Ribbon:  PhnA   35.8      10 0.00023   14.5  -0.2   11   75-85      4-14  (30)
217 PF03884 DUF329:  Domain of unk  35.6      13 0.00028   16.7   0.1   12   74-85      3-14  (57)
218 COG1655 Uncharacterized protei  35.0      15 0.00032   21.7   0.3   16   71-86     17-32  (267)
219 PF06170 DUF983:  Protein of un  34.9      16 0.00036   17.8   0.4   12   75-86     10-21  (86)
220 PF05741 zf-nanos:  Nanos RNA b  34.7      13 0.00028   16.6  -0.0   11   72-82     32-42  (55)
221 PF13453 zf-TFIIB:  Transcripti  34.2      36 0.00079   13.7   1.3   21   73-93     19-39  (41)
222 PF13240 zinc_ribbon_2:  zinc-r  34.1      12 0.00026   13.2  -0.1    6   76-81     16-21  (23)
223 PF09855 DUF2082:  Nucleic-acid  34.0      17 0.00038   16.7   0.3    7   74-80      1-7   (64)
224 PF14447 Prok-RING_4:  Prokaryo  33.8      17 0.00036   16.2   0.3   16   71-86     37-52  (55)
225 PF06689 zf-C4_ClpX:  ClpX C4-t  33.4      18 0.00038   14.8   0.3   11   75-85      3-13  (41)
226 KOG2164|consensus               33.3      53  0.0012   21.8   2.4   52   24-85    186-237 (513)
227 PF13821 DUF4187:  Domain of un  32.3      24 0.00051   15.6   0.6   20   72-91     26-45  (55)
228 PF14255 Cys_rich_CPXG:  Cystei  32.0      18  0.0004   15.8   0.3   10   75-84      2-11  (52)
229 KOG1088|consensus               31.7      20 0.00044   18.7   0.4   21   66-86     91-111 (124)
230 PF04810 zf-Sec23_Sec24:  Sec23  31.5      19 0.00042   14.6   0.3   16   68-83     19-34  (40)
231 COG4888 Uncharacterized Zn rib  31.4      20 0.00044   18.1   0.4   13   71-83     20-32  (104)
232 TIGR03830 CxxCG_CxxCG_HTH puta  30.5      54  0.0012   16.7   1.9   23   23-45     30-52  (127)
233 COG5151 SSL1 RNA polymerase II  30.5      39 0.00084   21.0   1.4   26   71-96    386-411 (421)
234 COG4306 Uncharacterized protei  30.1      24 0.00051   18.7   0.5   17   22-38     66-82  (160)
235 KOG3362|consensus               30.0      15 0.00032   19.9  -0.3   23   73-95    129-151 (156)
236 PF14375 Cys_rich_CWC:  Cystein  29.8      21 0.00045   15.3   0.2    8   76-83      1-8   (50)
237 smart00132 LIM Zinc-binding do  29.5      23 0.00051   13.4   0.4   11   73-83     27-37  (39)
238 PF07503 zf-HYPF:  HypF finger;  29.3      32  0.0007   13.7   0.7   13   23-35     20-32  (35)
239 COG4640 Predicted membrane pro  29.0      36 0.00077   21.9   1.2   20   70-89     12-31  (465)
240 smart00661 RPOL9 RNA polymeras  28.9      21 0.00044   15.1   0.1   14   72-85     19-32  (52)
241 PF03811 Zn_Tnp_IS1:  InsA N-te  28.9     5.4 0.00012   16.0  -1.6   17   63-79     19-35  (36)
242 TIGR00570 cdk7 CDK-activating   28.5      38 0.00082   21.0   1.2   53   25-86      4-56  (309)
243 PF04988 AKAP95:  A-kinase anch  27.9      45 0.00097   18.6   1.3   23   25-47      1-23  (165)
244 COG3478 Predicted nucleic-acid  27.9      31 0.00067   16.0   0.6    9   73-81      4-12  (68)
245 PF07649 C1_3:  C1-like domain;  27.8      23 0.00049   13.2   0.2   11   72-82     14-24  (30)
246 PF10164 DUF2367:  Uncharacteri  27.6      28 0.00062   17.5   0.5   13   71-83     86-98  (98)
247 PF02148 zf-UBP:  Zn-finger in   27.5      10 0.00022   17.0  -1.0   16   71-86      9-24  (63)
248 KOG4118|consensus               27.4      41 0.00088   15.6   0.9   22   74-95     39-60  (74)
249 PRK03824 hypA hydrogenase nick  27.2      21 0.00046   18.9   0.1   15   72-86     69-83  (135)
250 COG1885 Uncharacterized protei  27.2      29 0.00063   17.7   0.5   13   24-36     49-61  (115)
251 KOG1280|consensus               27.1      70  0.0015   20.3   2.1   27   22-48     77-103 (381)
252 COG3024 Uncharacterized protei  26.6      26 0.00056   16.2   0.2   11   74-84      8-18  (65)
253 PF03966 Trm112p:  Trm112p-like  26.3      23  0.0005   16.2   0.1   17   68-84     48-64  (68)
254 KOG3352|consensus               26.1      33 0.00071   18.8   0.6   16   22-37    131-146 (153)
255 PF01194 RNA_pol_N:  RNA polyme  25.4      48   0.001   15.1   1.0   17   23-39      3-19  (60)
256 cd00122 MBD MeCP2, MBD1, MBD2,  25.4      64  0.0014   14.4   1.4   19   77-95     31-49  (62)
257 COG1631 RPL42A Ribosomal prote  25.3      22 0.00048   17.7  -0.1   12   74-85     69-80  (94)
258 COG2879 Uncharacterized small   25.2      86  0.0019   14.5   1.9   17    8-24     24-40  (65)
259 TIGR00240 ATCase_reg aspartate  24.9      21 0.00046   19.5  -0.2   13   73-85    132-144 (150)
260 PRK00418 DNA gyrase inhibitor;  24.7      33 0.00071   15.7   0.4   11   73-83      6-16  (62)
261 KOG0562|consensus               24.3      56  0.0012   18.4   1.3   26   71-96    151-176 (184)
262 KOG4602|consensus               24.2      27 0.00058   21.0   0.1   11   72-82    267-277 (318)
263 PF13248 zf-ribbon_3:  zinc-rib  24.2      27 0.00059   12.6   0.1    9   25-33     17-25  (26)
264 PF14634 zf-RING_5:  zinc-RING   24.1      40 0.00088   13.7   0.6   11   71-81     34-44  (44)
265 PF10058 DUF2296:  Predicted in  24.1      30 0.00065   15.3   0.2   11   71-81     42-52  (54)
266 PTZ00303 phosphatidylinositol   23.7     8.9 0.00019   26.9  -2.0   34   25-58    461-494 (1374)
267 PF01363 FYVE:  FYVE zinc finge  23.0      37 0.00079   15.3   0.4   12   74-85     10-21  (69)
268 COG4847 Uncharacterized protei  23.0      34 0.00073   17.2   0.3   14   21-34      3-16  (103)
269 PF14952 zf-tcix:  Putative tre  22.9      35 0.00075   14.4   0.3    9   74-82     12-20  (44)
270 PF03119 DNA_ligase_ZBD:  NAD-d  22.9      35 0.00077   12.7   0.3    7   76-82      2-8   (28)
271 PF13696 zf-CCHC_2:  Zinc knuck  22.9      33 0.00072   13.4   0.2   10   24-33      8-17  (32)
272 PF07282 OrfB_Zn_ribbon:  Putat  22.0      35 0.00075   15.4   0.2   15   70-84     43-57  (69)
273 PF01844 HNH:  HNH endonuclease  21.9      35 0.00075   13.8   0.2   11   76-86      1-11  (47)
274 PF06676 DUF1178:  Protein of u  21.9      42 0.00092   18.3   0.5   24   22-45     30-53  (148)
275 PF14311 DUF4379:  Domain of un  21.7      44 0.00094   14.5   0.5   16   73-88     28-43  (55)
276 COG1571 Predicted DNA-binding   21.6      52  0.0011   21.3   1.0   18   69-86    363-380 (421)
277 PRK00893 aspartate carbamoyltr  21.4      36 0.00077   18.7   0.2   16   70-85    131-146 (152)
278 COG1545 Predicted nucleic-acid  21.3      32 0.00069   18.4   0.0   13   74-86     30-42  (140)
279 PF09963 DUF2197:  Uncharacteri  21.2      67  0.0015   14.4   1.0   12   23-34     30-41  (56)
280 PF02591 DUF164:  Putative zinc  21.2      94   0.002   13.5   1.5   12   70-81     43-54  (56)
281 PF14149 YhfH:  YhfH-like prote  21.0      31 0.00066   14.0  -0.1   11   74-84     14-24  (37)
282 PHA02998 RNA polymerase subuni  20.9      41 0.00089   19.1   0.4   13   74-86    172-184 (195)
283 smart00391 MBD Methyl-CpG bind  20.9      80  0.0017   15.0   1.3   19   77-95     34-52  (77)
284 KOG2907|consensus               20.9      30 0.00066   17.9  -0.1   12   74-85    103-114 (116)
285 COG1781 PyrI Aspartate carbamo  20.8      29 0.00062   19.0  -0.2   14   73-86    135-148 (153)
286 PRK00432 30S ribosomal protein  20.8      48  0.0011   14.3   0.5   12   72-83     36-47  (50)
287 PF12760 Zn_Tnp_IS1595:  Transp  20.7      88  0.0019   12.9   2.4    9   25-33     19-27  (46)
288 COG5539 Predicted cysteine pro  20.7      78  0.0017   19.5   1.5   26   20-45    271-296 (306)
289 COG1594 RPB9 DNA-directed RNA   20.6      33 0.00071   17.7  -0.0   11   74-84    101-111 (113)
290 cd01396 MeCP2_MBD MeCP2, MBD1,  20.5      80  0.0017   15.0   1.3   20   77-96     32-51  (77)
291 PF03470 zf-XS:  XS zinc finger  20.5      84  0.0018   13.3   1.2   11   82-93     11-21  (43)
292 PF14445 Prok-RING_2:  Prokaryo  20.4      32 0.00068   15.1  -0.1   11   74-84      8-18  (57)
293 KOG0801|consensus               20.3      41 0.00088   18.8   0.3   12   74-85    139-150 (205)
294 smart00586 ZnF_DBF Zinc finger  20.3      71  0.0015   13.9   1.0   22   21-45      2-23  (49)
295 PF10367 Vps39_2:  Vacuolar sor  20.1      45 0.00097   16.3   0.4   12   74-85     79-90  (109)
296 KOG2857|consensus               20.1      57  0.0012   17.8   0.8   22   24-45     17-38  (157)
297 smart00647 IBR In Between Ring  20.1      47   0.001   14.4   0.5   14   71-84     38-51  (64)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=2.6e-29  Score=139.64  Aligned_cols=97  Identities=32%  Similarity=0.692  Sum_probs=87.3

Q ss_pred             CcchhccCchHHHHHHhhccC---CCccccccccccccChHHHHHHHHHcc-----cccCccccChHHHHHHHHhccCCC
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEG---VKKFGCEYCSARFSQKISCRVHMLRHR-----DVCNKPYHRKSVLIAHLQSHEGVK   72 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~---~~~~~C~~C~~~f~~~~~l~~h~~~~~-----~~c~~~~~~~~~~~~h~~~h~~~~   72 (97)
                      +||+.|...++|.+|...|..   .+.+.|..||+.+.+...|..|+++|+     +.|||.|.++=.|+.|+++|+|||
T Consensus       135 eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEK  214 (279)
T KOG2462|consen  135 ECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEK  214 (279)
T ss_pred             ccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCC
Confidence            488999999999999998853   566889999999999999999999998     689999998888899999999999


Q ss_pred             CcccccchhhccChHHHHHHhhhcC
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      ||.|+.|+|+|.+.++|+.|+++|+
T Consensus       215 PF~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  215 PFSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             CccCCcccchhcchHHHHHHHHhhc
Confidence            9999999999999999999999984


No 2  
>KOG2462|consensus
Probab=99.93  E-value=1.6e-26  Score=128.59  Aligned_cols=93  Identities=30%  Similarity=0.517  Sum_probs=88.8

Q ss_pred             CcchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc-------cccCccccChHHHHHHHHhccCCCC
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHRKSVLIAHLQSHEGVKK   73 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~~~~~~~h~~~h~~~~~   73 (97)
                      .||++|.+...|+.|+++|+  -+.+|.+||+.|.....|+.|+|+|+       +.|+++|...++|+.|+++|.+.|+
T Consensus       166 ~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  166 YCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             CCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            59999999999999999997  68999999999999999999999999       5799999999999999999999999


Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      |+|..|+|+|+..+.|..|.+.
T Consensus       244 ~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  244 HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999864


No 3  
>KOG1074|consensus
Probab=99.87  E-value=1.5e-23  Score=130.33  Aligned_cols=48  Identities=44%  Similarity=0.801  Sum_probs=45.5

Q ss_pred             CcchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      .|.+.|.+.+.|..|++.|+|++||.|.+||.+|+++.+|+-|...|+
T Consensus       358 ~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~  405 (958)
T KOG1074|consen  358 FCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHR  405 (958)
T ss_pred             hhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeeeeecc
Confidence            489999999999999999999999999999999999999999988776


No 4  
>KOG1074|consensus
Probab=99.85  E-value=3.4e-22  Score=124.42  Aligned_cols=48  Identities=33%  Similarity=0.708  Sum_probs=46.4

Q ss_pred             ccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHhhhcC
Q psy13994         50 VCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        50 ~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      +|++.|...++|..|+++|+++|||.|.+|+++|....+|+.|+.+|.
T Consensus       884 vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  884 VCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             cchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccc
Confidence            699999999999999999999999999999999999999999999884


No 5  
>KOG3576|consensus
Probab=99.71  E-value=5.1e-18  Score=91.70  Aligned_cols=75  Identities=25%  Similarity=0.580  Sum_probs=68.8

Q ss_pred             CCCccccccccccccChHHHHHHHHHcc-------cccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHh
Q psy13994         21 GVKKFGCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHM   93 (97)
Q Consensus        21 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   93 (97)
                      +...+.|.+|++.|.....|..|+.-|.       ..||+.|...-.|++|+++|+|.+||+|..|+|+|.+.-.|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            3456899999999999999999999887       369999999999999999999999999999999999999999997


Q ss_pred             hh
Q psy13994         94 LR   95 (97)
Q Consensus        94 ~~   95 (97)
                      +.
T Consensus       194 ~k  195 (267)
T KOG3576|consen  194 KK  195 (267)
T ss_pred             HH
Confidence            64


No 6  
>KOG3623|consensus
Probab=99.68  E-value=1.1e-17  Score=103.93  Aligned_cols=94  Identities=33%  Similarity=0.618  Sum_probs=82.7

Q ss_pred             cchhccCchHHHHHHhhcc--CCCccccccccccccChHHHHHHHHHcc--------------------cccCccccChH
Q psy13994          2 CNKQYHRKSVLIAHLQSHE--GVKKFGCEYCSARFSQKISCRVHMLRHR--------------------DVCNKPYHRKS   59 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~~h~--~~~~~~C~~C~~~f~~~~~l~~h~~~~~--------------------~~c~~~~~~~~   59 (97)
                      |.+.+.....|+.|+...+  .+..|.|..|..+|.+...|.+|+..|.                    ..|+|+|...-
T Consensus       216 cdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKH  295 (1007)
T KOG3623|consen  216 CDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKH  295 (1007)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHH
Confidence            6667777788899987543  3445999999999999999999999886                    36999999999


Q ss_pred             HHHHHHHhccCCCCcccccchhhccChHHHHHHhhh
Q psy13994         60 VLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        60 ~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      .|+.|+++|.|||||.|+.|+|.|+....+..|+..
T Consensus       296 HLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  296 HLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             HHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            999999999999999999999999999999888753


No 7  
>KOG3623|consensus
Probab=99.68  E-value=1.4e-17  Score=103.41  Aligned_cols=70  Identities=33%  Similarity=0.646  Sum_probs=50.9

Q ss_pred             ccccccccccccChHHHHHHHHHcc-------cccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHh
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHM   93 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   93 (97)
                      +|.|+.|+++|...+.|.+|-.-|+       ..|.|+|...-.|..|++.|.|||||+|..|+|.|+....+.+|+
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            4555555555555555555544444       235556666667788999999999999999999999999999997


No 8  
>KOG3608|consensus
Probab=99.64  E-value=8.9e-16  Score=88.98  Aligned_cols=96  Identities=26%  Similarity=0.481  Sum_probs=79.6

Q ss_pred             cchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc---------------------------------
Q psy13994          2 CNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR---------------------------------   48 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~---------------------------------   48 (97)
                      |-+.+.+.+.|..|++.|++++-..|+.||.-|..+..|.-|++..+                                 
T Consensus       185 Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~y  264 (467)
T KOG3608|consen  185 CTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCY  264 (467)
T ss_pred             hhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcc
Confidence            56778888889999999988877777777777777777766666554                                 


Q ss_pred             --cccCccccChHHHHHHHHh-ccCCCCcccccchhhccChHHHHHHhhhcC
Q psy13994         49 --DVCNKPYHRKSVLIAHLQS-HEGVKKFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        49 --~~c~~~~~~~~~~~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                        +.|.-+....+.|..|++. |..++||+|..|++.|.+.+.|..|...|+
T Consensus       265 kCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  265 KCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence              5688888889999999885 778999999999999999999999998874


No 9  
>KOG3576|consensus
Probab=99.59  E-value=4.8e-16  Score=84.18  Aligned_cols=96  Identities=27%  Similarity=0.584  Sum_probs=75.6

Q ss_pred             CcchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc-------cccCccccChHHHHHHHHh-c----
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHRKSVLIAHLQS-H----   68 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~~~~~~~h~~~-h----   68 (97)
                      +|++.|.-.-.|.+|+.-|.+.+.+.|..||+.|...-+|+.|+++|+       ..|+++|.....|..|.+. |    
T Consensus       122 vCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~  201 (267)
T KOG3576|consen  122 VCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQH  201 (267)
T ss_pred             hhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchH
Confidence            577888777778888888887778888888888888888888888887       3577888888777777642 2    


Q ss_pred             ------cCCCCcccccchhhccChHHHHHHhhhc
Q psy13994         69 ------EGVKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        69 ------~~~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                            ..++.|.|+.||.+-.....+..|++.|
T Consensus       202 ~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~  235 (267)
T KOG3576|consen  202 QYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLH  235 (267)
T ss_pred             HHHHHHhhhheeeecccCCCCCChhHHHHHHHhc
Confidence                  2467899999999988888888888765


No 10 
>KOG3608|consensus
Probab=99.50  E-value=8.6e-14  Score=80.94  Aligned_cols=95  Identities=23%  Similarity=0.495  Sum_probs=81.8

Q ss_pred             CcchhccCchHHHHHHhh-ccCCCccccccccccccChHHHHHHHHHcc--------cccCccccChHHHHHHHHh-ccC
Q psy13994          1 VCNKQYHRKSVLIAHLQS-HEGVKKFGCEYCSARFSQKISCRVHMLRHR--------DVCNKPYHRKSVLIAHLQS-HEG   70 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~--------~~c~~~~~~~~~~~~h~~~-h~~   70 (97)
                      +|+..-...+.|..|++. |..++||+|+.|+..+...++|.+|...|.        +.|...+.....+..|.+. |.|
T Consensus       268 lCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg  347 (467)
T KOG3608|consen  268 LCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEG  347 (467)
T ss_pred             ccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccC
Confidence            467777788899999885 778999999999999999999999999887        4588888888999999875 445


Q ss_pred             CC--CcccccchhhccChHHHHHHhhh
Q psy13994         71 VK--KFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        71 ~~--~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      .+  +|.|..|++.|+...+|..|++.
T Consensus       348 ~np~~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  348 NNPILYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             CCCCceeeecchhhhccchhHHHHHHH
Confidence            44  69999999999999999999875


No 11 
>KOG3993|consensus
Probab=99.37  E-value=1.9e-13  Score=80.90  Aligned_cols=96  Identities=20%  Similarity=0.366  Sum_probs=71.4

Q ss_pred             CcchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcccc--cCcc--------ccChHHHHHHHH--hc
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHRDV--CNKP--------YHRKSVLIAHLQ--SH   68 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~--c~~~--------~~~~~~~~~h~~--~h   68 (97)
                      +|...|.+...|.+|....+....|+|++|++.|+...+|..|+|+|.+.  -.++        .......+.-.+  ..
T Consensus       272 LCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~d  351 (500)
T KOG3993|consen  272 LCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDD  351 (500)
T ss_pred             HHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCc
Confidence            47788999999999999988888999999999999999999999999832  1110        011111100000  01


Q ss_pred             cCCCCcccccchhhccChHHHHHHhhhc
Q psy13994         69 EGVKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        69 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ..+..|.|..|+|.|.....|+.|+.+|
T Consensus       352 ss~gi~~C~~C~KkFrRqAYLrKHqlth  379 (500)
T KOG3993|consen  352 SSSGIFSCHTCGKKFRRQAYLRKHQLTH  379 (500)
T ss_pred             ccCceeecHHhhhhhHHHHHHHHhHHhh
Confidence            2234799999999999999999998876


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.32  E-value=8.9e-13  Score=49.96  Aligned_cols=26  Identities=38%  Similarity=0.869  Sum_probs=23.9

Q ss_pred             HHHHHHHhccCCCCcccccchhhccC
Q psy13994         60 VLIAHLQSHEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        60 ~~~~h~~~h~~~~~~~C~~C~~~f~~   85 (97)
                      +|..|++.|.+++||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999974


No 13 
>PHA00733 hypothetical protein
Probab=99.23  E-value=1.9e-11  Score=63.14  Aligned_cols=73  Identities=14%  Similarity=0.194  Sum_probs=55.6

Q ss_pred             CCccccccccccccChHHHHHH--HHHcc----------cccCccccChHHHHHHHHhccCCCCcccccchhhccChHHH
Q psy13994         22 VKKFGCEYCSARFSQKISCRVH--MLRHR----------DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISC   89 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h--~~~~~----------~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l   89 (97)
                      .+++.|.+|+..|.....|..+  +..+.          +.|++.|.....|..|++.+  +.+|.|..|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4567888888777777666655  11111          46888888888888888866  3579999999999999999


Q ss_pred             HHHhhhc
Q psy13994         90 RVHMLRH   96 (97)
Q Consensus        90 ~~H~~~h   96 (97)
                      ..|+...
T Consensus       116 ~~H~~~~  122 (128)
T PHA00733        116 LDHVCKK  122 (128)
T ss_pred             HHHHHHh
Confidence            9998763


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.23  E-value=7.6e-12  Score=47.37  Aligned_cols=26  Identities=38%  Similarity=0.869  Sum_probs=23.8

Q ss_pred             HHHHHHhhccCCCccccccccccccC
Q psy13994         11 VLIAHLQSHEGVKKFGCEYCSARFSQ   36 (97)
Q Consensus        11 ~l~~h~~~h~~~~~~~C~~C~~~f~~   36 (97)
                      +|..|+++|++++||.|+.|+++|..
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999999999999999999863


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.16  E-value=1.5e-11  Score=53.85  Aligned_cols=38  Identities=18%  Similarity=0.385  Sum_probs=28.4

Q ss_pred             cCccccChHHHHHHHHhccCCCCcccccchhhccChHHHH
Q psy13994         51 CNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCR   90 (97)
Q Consensus        51 c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~   90 (97)
                      ||+.|...++|..|++.|.  ++|+|..|++.|.+.+.|.
T Consensus        11 CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768         11 CGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             hCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4455555666677777777  6899999999999877663


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.04  E-value=8.4e-10  Score=68.64  Aligned_cols=86  Identities=15%  Similarity=0.372  Sum_probs=57.2

Q ss_pred             cchhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc-------cccCccccC----------hHHHHHH
Q psy13994          2 CNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHR----------KSVLIAH   64 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~----------~~~~~~h   64 (97)
                      |++.|. ...|..|+..++  +|+.|+ ||..+ ....|..|+..+.       +.|++.+..          ...|..|
T Consensus       459 Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~H  533 (567)
T PLN03086        459 CGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEH  533 (567)
T ss_pred             CCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHH
Confidence            666664 466778887764  677887 87644 5577777776655       356666642          2357777


Q ss_pred             HHhccCCCCcccccchhhccChHHHHHHhh
Q psy13994         65 LQSHEGVKKFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        65 ~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      .... |.+++.|..||+.+... .|..|+.
T Consensus       534 E~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~  561 (567)
T PLN03086        534 ESIC-GSRTAPCDSCGRSVMLK-EMDIHQI  561 (567)
T ss_pred             HHhc-CCcceEccccCCeeeeh-hHHHHHH
Confidence            7764 67788888888777655 5566654


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.99  E-value=2e-10  Score=50.34  Aligned_cols=35  Identities=20%  Similarity=0.450  Sum_probs=18.9

Q ss_pred             cchhccCchHHHHHHhhccCCCccccccccccccChH
Q psy13994          2 CNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKI   38 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~   38 (97)
                      ||+.|...++|..|+++|+  +|+.|..|++.|...+
T Consensus        11 CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s   45 (55)
T PHA02768         11 CGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTG   45 (55)
T ss_pred             hCCeeccHHHHHHHHHhcC--CcccCCcccceecccc
Confidence            5555555555555555554  4555555555554433


No 18 
>PHA00733 hypothetical protein
Probab=98.89  E-value=4.5e-09  Score=54.38  Aligned_cols=50  Identities=22%  Similarity=0.500  Sum_probs=43.8

Q ss_pred             cCCCccccccccccccChHHHHHHHHHcc-----cccCccccChHHHHHHHHhcc
Q psy13994         20 EGVKKFGCEYCSARFSQKISCRVHMLRHR-----DVCNKPYHRKSVLIAHLQSHE   69 (97)
Q Consensus        20 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~-----~~c~~~~~~~~~~~~h~~~h~   69 (97)
                      .+++||.|+.||+.|.....|..|++.+.     +.|++.|.....|..|+....
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            45889999999999999999999998542     689999999999999987654


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.82  E-value=1.2e-08  Score=63.69  Aligned_cols=71  Identities=18%  Similarity=0.331  Sum_probs=58.6

Q ss_pred             CCccccccccccccChHHHHHHHHHcc-----cccCccccChHHHHHHHHhccCCCCcccccchhhccC----------h
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHR-----DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQ----------K   86 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~-----~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~----------~   86 (97)
                      ++++.|+.|++.|. ...|..|+..++     + |++.+ ....|..|+..|..++++.|..|++.|..          .
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~  527 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFHEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRL  527 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcCCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhh
Confidence            45678999999996 678999999865     4 88655 56899999999999999999999999852          4


Q ss_pred             HHHHHHhhh
Q psy13994         87 ISCRVHMLR   95 (97)
Q Consensus        87 ~~l~~H~~~   95 (97)
                      +.|..|...
T Consensus       528 s~Lt~HE~~  536 (567)
T PLN03086        528 RGMSEHESI  536 (567)
T ss_pred             hhHHHHHHh
Confidence            578888765


No 20 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.79  E-value=2.6e-09  Score=39.17  Aligned_cols=23  Identities=39%  Similarity=0.801  Sum_probs=21.3

Q ss_pred             cccccchhhccChHHHHHHhhhc
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999875


No 21 
>PHA00616 hypothetical protein
Probab=98.79  E-value=3.2e-09  Score=44.50  Aligned_cols=25  Identities=24%  Similarity=0.482  Sum_probs=23.4

Q ss_pred             CcccccchhhccChHHHHHHhhhcC
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      ||+|+.||+.|.+.++|..|+++|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h   25 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH   25 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc
Confidence            6899999999999999999999874


No 22 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.73  E-value=1.4e-09  Score=62.98  Aligned_cols=71  Identities=20%  Similarity=0.368  Sum_probs=50.9

Q ss_pred             CCcccccc--ccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHhh
Q psy13994         22 VKKFGCEY--CSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        22 ~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      ++||.|++  |.+++.....|+-|+...+  |.........-..+...-..+|||+|++|+|.|.....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH--~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGH--QNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccc--cCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999976  9999999999999987544  22211111122233334566899999999999999999877754


No 23 
>KOG3993|consensus
Probab=98.73  E-value=4.9e-09  Score=62.76  Aligned_cols=95  Identities=22%  Similarity=0.379  Sum_probs=68.5

Q ss_pred             CcchhccCchHHHHHHhhccC--------C-------------------------CccccccccccccChHHHHHHHHHc
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEG--------V-------------------------KKFGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~--------~-------------------------~~~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      +|+++|.-..+|..|.+.|.-        .                         -.|.|.+|++.|.....|..|+.+|
T Consensus       300 EC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlth  379 (500)
T KOG3993|consen  300 ECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTH  379 (500)
T ss_pred             cccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhh
Confidence            699999999999999999831        1                         1378999999999999999999888


Q ss_pred             c-----------------------------------------------------cccCccccChHHHHHHHHhccCCCCc
Q psy13994         48 R-----------------------------------------------------DVCNKPYHRKSVLIAHLQSHEGVKKF   74 (97)
Q Consensus        48 ~-----------------------------------------------------~~c~~~~~~~~~~~~h~~~h~~~~~~   74 (97)
                      +                                                     +.++..+.++..--.+.+.-..+.-|
T Consensus       380 q~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f  459 (500)
T KOG3993|consen  380 QRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGF  459 (500)
T ss_pred             hccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhcc
Confidence            7                                                     12332222222222222222234568


Q ss_pred             ccccchhhccChHHHHHHhhh
Q psy13994         75 GCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        75 ~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      .|..|--+|.....|.+|+.+
T Consensus       460 ~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  460 TCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             ccccchHhhhcCcchHhHhhh
Confidence            899999999999999998765


No 24 
>PHA00732 hypothetical protein
Probab=98.68  E-value=1.5e-08  Score=48.15  Aligned_cols=22  Identities=18%  Similarity=0.362  Sum_probs=15.9

Q ss_pred             ccccccccccccChHHHHHHHH
Q psy13994         24 KFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      ||.|..||+.|.....|..|++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r   22 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHAR   22 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhh
Confidence            5678888777777777776665


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.54  E-value=4.8e-08  Score=37.11  Aligned_cols=25  Identities=32%  Similarity=0.564  Sum_probs=23.0

Q ss_pred             CcccccchhhccChHHHHHHhhhcC
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999998873


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.53  E-value=5.3e-08  Score=35.75  Aligned_cols=24  Identities=38%  Similarity=0.728  Sum_probs=20.0

Q ss_pred             cccccchhhccChHHHHHHhhhcC
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      |.|++|++.|.+...|..|+++|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999863


No 27 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.52  E-value=6.2e-08  Score=47.87  Aligned_cols=70  Identities=23%  Similarity=0.426  Sum_probs=21.2

Q ss_pred             ccccccccccChHHHHHHHHHccccc---CccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHhhhc
Q psy13994         26 GCEYCSARFSQKISCRVHMLRHRDVC---NKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        26 ~C~~C~~~f~~~~~l~~h~~~~~~~c---~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      .|..|+..|.....+..|+...+...   ...+.....+..+.+... ...+.|..|++.|.....|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccccccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            47889999999999999987666321   111222233333333222 23689999999999999999999864


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=2.3e-07  Score=33.80  Aligned_cols=22  Identities=36%  Similarity=0.747  Sum_probs=19.6

Q ss_pred             cccccccccccChHHHHHHHHH
Q psy13994         25 FGCEYCSARFSQKISCRVHMLR   46 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~   46 (97)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5799999999999999999876


No 29 
>smart00355 ZnF_C2H2 zinc finger.
Probab=98.25  E-value=8.3e-07  Score=32.94  Aligned_cols=23  Identities=30%  Similarity=0.651  Sum_probs=21.1

Q ss_pred             cccccchhhccChHHHHHHhhhc
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      |.|+.|+++|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57999999999999999999876


No 30 
>PHA00616 hypothetical protein
Probab=98.24  E-value=6.2e-07  Score=37.66  Aligned_cols=34  Identities=32%  Similarity=0.552  Sum_probs=20.9

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCccccc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEY   78 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~   78 (97)
                      ||.|..||+.|.....                     +..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~---------------------l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKE---------------------VIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHH---------------------HHHHHHHhcCCCccceeE
Confidence            5677777666655554                     555555666666666543


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.21  E-value=1.5e-06  Score=31.71  Aligned_cols=23  Identities=39%  Similarity=0.751  Sum_probs=18.5

Q ss_pred             cccccccccccChHHHHHHHHHc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      |.|++|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57999999999999999998875


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.17  E-value=1e-06  Score=33.31  Aligned_cols=25  Identities=32%  Similarity=0.564  Sum_probs=21.6

Q ss_pred             ccccccccccccChHHHHHHHHHcc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      ||.|..|++.|.....|..|++.+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6889999999999999999987653


No 33 
>PHA00732 hypothetical protein
Probab=98.15  E-value=1.6e-06  Score=41.26  Aligned_cols=42  Identities=17%  Similarity=0.331  Sum_probs=33.7

Q ss_pred             CcchhccCchHHHHHHhh-ccCCCccccccccccccChHHHHHHHHHcc
Q psy13994          1 VCNKQYHRKSVLIAHLQS-HEGVKKFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      +|++.|.....|..|++. |.   ++.|+.||+.|.   .+..|..+..
T Consensus         6 ~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          6 ICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            589999999999999984 54   358999999997   4666765544


No 34 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.92  E-value=5.4e-06  Score=30.69  Aligned_cols=23  Identities=35%  Similarity=0.681  Sum_probs=20.7

Q ss_pred             cccccchhhccChHHHHHHhhhc
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      |.|.+|++.|.....++.|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999999864


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.67  E-value=4.9e-05  Score=27.88  Aligned_cols=23  Identities=30%  Similarity=0.651  Sum_probs=18.4

Q ss_pred             cccccccccccChHHHHHHHHHc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      +.|..|++.|.....+..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46888988888888888887743


No 36 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.64  E-value=3.1e-05  Score=28.57  Aligned_cols=22  Identities=36%  Similarity=0.703  Sum_probs=19.2

Q ss_pred             cccccccccccChHHHHHHHHH
Q psy13994         25 FGCEYCSARFSQKISCRVHMLR   46 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~   46 (97)
                      |.|.+|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5799999999999999999864


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.61  E-value=5.4e-05  Score=32.64  Aligned_cols=29  Identities=21%  Similarity=0.319  Sum_probs=20.2

Q ss_pred             ccCCCCcccccchhhccChHHHHHHhhhc
Q psy13994         68 HEGVKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        68 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ...+.|-.|++|+..+.+..+|++|+++.
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~   47 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIR   47 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHH
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHH
Confidence            34567889999999999999999999763


No 38 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.58  E-value=1.6e-05  Score=30.01  Aligned_cols=22  Identities=32%  Similarity=0.614  Sum_probs=20.1

Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999875


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.55  E-value=5.1e-05  Score=27.72  Aligned_cols=22  Identities=36%  Similarity=0.652  Sum_probs=17.7

Q ss_pred             cccccchhhccChHHHHHHhhhc
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      |+|+.|+.... ...|.+|+++|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            68999999888 88999999874


No 40 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.54  E-value=0.00029  Score=31.06  Aligned_cols=50  Identities=26%  Similarity=0.414  Sum_probs=31.1

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCC-CCcccccchhhccChHHHHHHhhhc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGV-KKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      .|.|+.|++ ......|..|...                    .|..+ +.+.|++|...+.  .+|..|+..+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~--------------------~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCED--------------------EHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHh--------------------HCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            367777777 3334445444332                    24333 4688999998655  4888998764


No 41 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.51  E-value=0.0001  Score=36.27  Aligned_cols=20  Identities=15%  Similarity=0.564  Sum_probs=0.0

Q ss_pred             CcchhccCchHHHHHHhhcc
Q psy13994          1 VCNKQYHRKSVLIAHLQSHE   20 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~   20 (97)
                      .|+..|.+...|..|+...+
T Consensus         4 ~C~~~f~~~~~l~~H~~~~H   23 (100)
T PF12756_consen    4 FCDESFSSVDDLLQHMKKKH   23 (100)
T ss_dssp             --------------------
T ss_pred             cccccccccccccccccccc
Confidence            47888888888888886543


No 42 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.41  E-value=0.00044  Score=30.51  Aligned_cols=44  Identities=27%  Similarity=0.470  Sum_probs=31.6

Q ss_pred             CcchhccCchHHHHHHhh-ccC-CCccccccccccccChHHHHHHHHHc
Q psy13994          1 VCNKQYHRKSVLIAHLQS-HEG-VKKFGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~-h~~-~~~~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      .|++ ..+...|..|... |.. .+.+.|++|...+.  .+|..|+...
T Consensus         7 ~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    7 YCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            4788 4567889999765 444 35699999997644  4777777654


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.25  E-value=0.0004  Score=30.02  Aligned_cols=30  Identities=20%  Similarity=0.315  Sum_probs=20.1

Q ss_pred             ccCCCccccccccccccChHHHHHHHHHcc
Q psy13994         19 HEGVKKFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        19 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      +..+.|..|++|+..+....+|..|+...+
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHh
Confidence            345788999999999999999999986543


No 44 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.11  E-value=0.00012  Score=43.18  Aligned_cols=44  Identities=27%  Similarity=0.532  Sum_probs=36.5

Q ss_pred             cchhccCchHHHHHHhhcc-------------------CCCccccccccccccChHHHHHHHH
Q psy13994          2 CNKQYHRKSVLIAHLQSHE-------------------GVKKFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      |++.|.....|+.|+..-+                   .++||+|.+|++.+...+.|+-|+.
T Consensus       357 C~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         357 CNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             chhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            8899999999999986422                   1489999999999999999888754


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.10  E-value=9.2e-05  Score=27.88  Aligned_cols=22  Identities=32%  Similarity=0.614  Sum_probs=18.8

Q ss_pred             cccccccccccChHHHHHHHHH
Q psy13994         25 FGCEYCSARFSQKISCRVHMLR   46 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~   46 (97)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999888753


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.99  E-value=0.00068  Score=24.63  Aligned_cols=22  Identities=36%  Similarity=0.652  Sum_probs=16.3

Q ss_pred             cccccccccccChHHHHHHHHHc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      |.|+.|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            57899998887 88888888764


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.88  E-value=0.00078  Score=26.75  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=20.4

Q ss_pred             CcccccchhhccChHHHHHHhhh
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999999764


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.80  E-value=0.0011  Score=24.47  Aligned_cols=21  Identities=19%  Similarity=0.360  Sum_probs=16.8

Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      ..|+.||+.| ....|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4699999999 56678888765


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=96.67  E-value=0.0013  Score=35.60  Aligned_cols=30  Identities=17%  Similarity=0.344  Sum_probs=26.1

Q ss_pred             ChHHHHHHHHhccCCCCcccccchhhccCh
Q psy13994         57 RKSVLIAHLQSHEGVKKFGCEYCSARFSQK   86 (97)
Q Consensus        57 ~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~   86 (97)
                      ....+..|.+++.++++|.|..|+..|...
T Consensus       127 ~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        127 HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            566788999999999999999999988754


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.43  E-value=0.0027  Score=25.13  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=19.7

Q ss_pred             ccccccccccccChHHHHHHHHH
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLR   46 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~   46 (97)
                      +|.|.+|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999988888888764


No 51 
>PRK04860 hypothetical protein; Provisional
Probab=96.40  E-value=0.0017  Score=35.09  Aligned_cols=30  Identities=17%  Similarity=0.344  Sum_probs=23.0

Q ss_pred             CchHHHHHHhhccCCCccccccccccccCh
Q psy13994          8 RKSVLIAHLQSHEGVKKFGCEYCSARFSQK   37 (97)
Q Consensus         8 ~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   37 (97)
                      ....+..|.+++.++++|.|..|+..|...
T Consensus       127 ~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        127 HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            456677888888888888888888877644


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.32  E-value=0.00019  Score=43.63  Aligned_cols=47  Identities=38%  Similarity=0.738  Sum_probs=41.6

Q ss_pred             cchhccCchHHHHHHh--hccCC--Cccccc--cccccccChHHHHHHHHHcc
Q psy13994          2 CNKQYHRKSVLIAHLQ--SHEGV--KKFGCE--YCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus         2 C~~~f~~~~~l~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~h~~~~~   48 (97)
                      |...|.....+..|.+  .|.++  +|+.|+  .|++.|.....+..|...+.
T Consensus       295 ~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         295 CNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             ccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            5677888888999999  79999  999999  79999999999999988776


No 53 
>KOG1146|consensus
Probab=96.17  E-value=0.0012  Score=45.61  Aligned_cols=75  Identities=17%  Similarity=0.275  Sum_probs=53.3

Q ss_pred             ccCCCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHh------ccCCCCcccccchhhccChHHHHHH
Q psy13994         19 HEGVKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQS------HEGVKKFGCEYCSARFSQKISCRVH   92 (97)
Q Consensus        19 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~------h~~~~~~~C~~C~~~f~~~~~l~~H   92 (97)
                      +...+.+.|+.|+..+.....|..|++..++.-+..+.  .+.+.|.+.      -.+-++|.|..|..+++...+|.+|
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c--~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsih  537 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYC--KAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIH  537 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHh--HhccccccccccccccCCCCcccceeeeeeeecchHHHHH
Confidence            45567899999999999999999999986633221111  111122211      2334789999999999999999999


Q ss_pred             hhh
Q psy13994         93 MLR   95 (97)
Q Consensus        93 ~~~   95 (97)
                      +..
T Consensus       538 lqS  540 (1406)
T KOG1146|consen  538 LQS  540 (1406)
T ss_pred             HHH
Confidence            864


No 54 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.04  E-value=0.015  Score=25.66  Aligned_cols=27  Identities=19%  Similarity=0.426  Sum_probs=22.7

Q ss_pred             ccCCCCcccccchhhccChHHHHHHhh
Q psy13994         68 HEGVKKFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        68 h~~~~~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      ..||--++|+-|+..|.....+.+|.-
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhh
Confidence            456777899999999999999888853


No 55 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.73  E-value=0.017  Score=22.70  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=7.9

Q ss_pred             CCcccccchh
Q psy13994         72 KKFGCEYCSA   81 (97)
Q Consensus        72 ~~~~C~~C~~   81 (97)
                      .++.|++|+.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            5788999874


No 56 
>KOG1146|consensus
Probab=94.70  E-value=0.0067  Score=42.25  Aligned_cols=69  Identities=13%  Similarity=0.199  Sum_probs=45.4

Q ss_pred             CCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHHHhhh
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      ..+|.|..|...|...+.+..|++    .|.+.+....-..-+...+.....| |..|...|+....|+.|+++
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~----k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQR----KFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHH----HHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHH
Confidence            346778888888888887777763    2333333222222233333434556 99999999999999999985


No 57 
>KOG4173|consensus
Probab=94.55  E-value=0.036  Score=31.19  Aligned_cols=71  Identities=23%  Similarity=0.525  Sum_probs=51.9

Q ss_pred             cccccc--ccccccChHHHHHHHHHcc----cccCccccChHHHHHHHH----------hccCCCCccc--ccchhhccC
Q psy13994         24 KFGCEY--CSARFSQKISCRVHMLRHR----DVCNKPYHRKSVLIAHLQ----------SHEGVKKFGC--EYCSARFSQ   85 (97)
Q Consensus        24 ~~~C~~--C~~~f~~~~~l~~h~~~~~----~~c~~~~~~~~~~~~h~~----------~h~~~~~~~C--~~C~~~f~~   85 (97)
                      .+.|++  |-+.|........|..+-+    ..|.+.|.+.-.|..|+.          ...|..-|+|  +.|+..|.+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT  158 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKT  158 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhh
Confidence            366765  7788888888888776544    467788888777777763          2345556888  559999999


Q ss_pred             hHHHHHHhh
Q psy13994         86 KISCRVHML   94 (97)
Q Consensus        86 ~~~l~~H~~   94 (97)
                      ......|+-
T Consensus       159 ~r~RkdH~I  167 (253)
T KOG4173|consen  159 SRDRKDHMI  167 (253)
T ss_pred             hhhhhhHHH
Confidence            988888853


No 58 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=94.11  E-value=0.044  Score=22.93  Aligned_cols=25  Identities=24%  Similarity=0.480  Sum_probs=16.3

Q ss_pred             CCCCcccccchhhccCh----HHHHHHhh
Q psy13994         70 GVKKFGCEYCSARFSQK----ISCRVHML   94 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~~----~~l~~H~~   94 (97)
                      ++....|..|++.+...    +.|..|++
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            44567899999988874    88999984


No 59 
>KOG2231|consensus
Probab=93.49  E-value=0.15  Score=33.78  Aligned_cols=60  Identities=18%  Similarity=0.183  Sum_probs=36.5

Q ss_pred             cChHHHHHHHHHccc---------------ccCccccChHHHHHHHHhccC-CC----CcccccchhhccChHHHHHHhh
Q psy13994         35 SQKISCRVHMLRHRD---------------VCNKPYHRKSVLIAHLQSHEG-VK----KFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        35 ~~~~~l~~h~~~~~~---------------~c~~~~~~~~~~~~h~~~h~~-~~----~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      .+...|..|+...+.               .+.+. -....|+.|++.-.- +.    .-.|+.|...|.....|..|++
T Consensus       125 ~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~-Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKL-YTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             hHHHHHHHHHHHhhhhhccccccccceeeeeeeeh-ehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhc
Confidence            366778888866552               12222 235566667654221 22    1347888888888888888877


Q ss_pred             h
Q psy13994         95 R   95 (97)
Q Consensus        95 ~   95 (97)
                      .
T Consensus       204 ~  204 (669)
T KOG2231|consen  204 F  204 (669)
T ss_pred             c
Confidence            5


No 60 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=93.38  E-value=0.049  Score=29.72  Aligned_cols=13  Identities=38%  Similarity=0.726  Sum_probs=10.2

Q ss_pred             ccCCCCcccccch
Q psy13994         68 HEGVKKFGCEYCS   80 (97)
Q Consensus        68 h~~~~~~~C~~C~   80 (97)
                      +.++.|-+||+||
T Consensus       144 ~~ge~P~~CPiCg  156 (166)
T COG1592         144 HEGEAPEVCPICG  156 (166)
T ss_pred             ccCCCCCcCCCCC
Confidence            3457788999998


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.82  E-value=0.012  Score=35.89  Aligned_cols=47  Identities=38%  Similarity=0.730  Sum_probs=38.8

Q ss_pred             ccCccccChHHHHHHHH--hccCC--CCcccc--cchhhccChHHHHHHhhhc
Q psy13994         50 VCNKPYHRKSVLIAHLQ--SHEGV--KKFGCE--YCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        50 ~c~~~~~~~~~~~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h   96 (97)
                      .|...|.....+..|.+  .|.++  +++.|+  .|++.|.....+..|..+|
T Consensus       294 ~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  346 (467)
T COG5048         294 QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH  346 (467)
T ss_pred             cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc
Confidence            46667777778888888  78888  899998  7999999998888887765


No 62 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=92.24  E-value=0.094  Score=22.61  Aligned_cols=23  Identities=30%  Similarity=0.764  Sum_probs=18.3

Q ss_pred             cccccchhhccCh-----HHHHHHhh-hc
Q psy13994         74 FGCEYCSARFSQK-----ISCRVHML-RH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~-----~~l~~H~~-~h   96 (97)
                      -.|..|++.++..     +.|.+|++ +|
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            4599999988766     68999988 44


No 63 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.53  E-value=0.22  Score=25.47  Aligned_cols=73  Identities=15%  Similarity=0.239  Sum_probs=42.4

Q ss_pred             CCccccccccccccChHHHHHHHHHcc-------------------cccCccccChHHHHHHHHhccCCCCcccccchhh
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHR-------------------DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSAR   82 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~-------------------~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~   82 (97)
                      +-|..|++||-+......|.+....--                   -.|...|........  ..-.....|+|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCc
Confidence            457888899888877777764321100                   124444443211000  00112346999999999


Q ss_pred             ccChHHHHHHhhhc
Q psy13994         83 FSQKISCRVHMLRH   96 (97)
Q Consensus        83 f~~~~~l~~H~~~h   96 (97)
                      |-..-+.-.|...|
T Consensus        91 FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        91 FCVDCDVFVHESLH  104 (112)
T ss_pred             cccccchhhhhhcc
Confidence            98877777777665


No 64 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=90.91  E-value=0.23  Score=18.40  Aligned_cols=19  Identities=16%  Similarity=0.293  Sum_probs=14.8

Q ss_pred             ccccchhhccChHHHHHHhh
Q psy13994         75 GCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        75 ~C~~C~~~f~~~~~l~~H~~   94 (97)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            599999988 5567778875


No 65 
>PHA00626 hypothetical protein
Probab=90.31  E-value=0.12  Score=22.89  Aligned_cols=16  Identities=19%  Similarity=0.360  Sum_probs=13.2

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      ...|.|+.||..|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            4689999999988753


No 66 
>KOG2893|consensus
Probab=90.17  E-value=0.086  Score=30.49  Aligned_cols=19  Identities=26%  Similarity=0.534  Sum_probs=9.3

Q ss_pred             cccccccccChHHHHHHHH
Q psy13994         27 CEYCSARFSQKISCRVHML   45 (97)
Q Consensus        27 C~~C~~~f~~~~~l~~h~~   45 (97)
                      |..|.+.|.....|.+|+.
T Consensus        13 cwycnrefddekiliqhqk   31 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK   31 (341)
T ss_pred             eeecccccchhhhhhhhhh
Confidence            5555555554444444443


No 67 
>KOG4173|consensus
Probab=90.17  E-value=0.31  Score=27.65  Aligned_cols=60  Identities=15%  Similarity=0.362  Sum_probs=41.3

Q ss_pred             hhccCchHHHHHHhhccCCCccccccccccccChHHHHHHHHHcc-------------------cccCccccChHHHHHH
Q psy13994          4 KQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHR-------------------DVCNKPYHRKSVLIAH   64 (97)
Q Consensus         4 ~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~-------------------~~c~~~~~~~~~~~~h   64 (97)
                      ..|.....+..|...-++   -.|..|.+.|.+...|..|+.-.+                   ..|+..|...-.-..|
T Consensus        89 ~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH  165 (253)
T KOG4173|consen   89 QVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDH  165 (253)
T ss_pred             HHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhH
Confidence            344444444455443333   379999999999999999987665                   3588888887777777


Q ss_pred             HH
Q psy13994         65 LQ   66 (97)
Q Consensus        65 ~~   66 (97)
                      +.
T Consensus       166 ~I  167 (253)
T KOG4173|consen  166 MI  167 (253)
T ss_pred             HH
Confidence            64


No 68 
>KOG2785|consensus
Probab=90.15  E-value=0.39  Score=29.69  Aligned_cols=71  Identities=18%  Similarity=0.343  Sum_probs=45.3

Q ss_pred             cccccccccccChHHHHHHHHHcc-------------cccCccccChHH-HHH--HHHhccCCCCcccccchhhccChHH
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRHR-------------DVCNKPYHRKSV-LIA--HLQSHEGVKKFGCEYCSARFSQKIS   88 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~~-------------~~c~~~~~~~~~-~~~--h~~~h~~~~~~~C~~C~~~f~~~~~   88 (97)
                      |.|..|...|........|+.+..             +.-...|..... ...  -.....++-++.|..|.+.|.....
T Consensus         4 ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a   83 (390)
T KOG2785|consen    4 FTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKA   83 (390)
T ss_pred             ceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhh
Confidence            678999999988888888876532             111112221111 000  1112344567889999999999999


Q ss_pred             HHHHhhh
Q psy13994         89 CRVHMLR   95 (97)
Q Consensus        89 l~~H~~~   95 (97)
                      ...|+..
T Consensus        84 ~~~hl~S   90 (390)
T KOG2785|consen   84 HENHLKS   90 (390)
T ss_pred             HHHHHHH
Confidence            9999764


No 69 
>KOG2893|consensus
Probab=89.97  E-value=0.07  Score=30.84  Aligned_cols=39  Identities=26%  Similarity=0.684  Sum_probs=29.3

Q ss_pred             CcchhccCchHHHHHHhhccCCCccccccccccccChHHHHHH
Q psy13994          1 VCNKQYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVH   43 (97)
Q Consensus         1 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h   43 (97)
                      .|.+.|.+...|.+|++    .+-|+|.+|.+...+-..|..|
T Consensus        15 ycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            48889999999988885    4569999998776555444444


No 70 
>KOG0717|consensus
Probab=87.94  E-value=0.31  Score=30.98  Aligned_cols=22  Identities=18%  Similarity=0.375  Sum_probs=19.4

Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +-|.+|+|+|.+..+|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            5599999999999999999653


No 71 
>KOG3408|consensus
Probab=87.88  E-value=0.47  Score=24.57  Aligned_cols=26  Identities=23%  Similarity=0.439  Sum_probs=22.5

Q ss_pred             CCCCcccccchhhccChHHHHHHhhh
Q psy13994         70 GVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      |-..|-|..|.+-|.+...|+.|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44568899999999999999999875


No 72 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=87.29  E-value=0.52  Score=26.99  Aligned_cols=27  Identities=22%  Similarity=0.491  Sum_probs=21.4

Q ss_pred             CCccccccccccccChHHHHHHHHHcc
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      +.-|.|.+|++.|....-+.+|+...+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            445999999999999999999998866


No 73 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=87.22  E-value=0.21  Score=18.22  Aligned_cols=10  Identities=30%  Similarity=0.743  Sum_probs=8.1

Q ss_pred             CCcccccchh
Q psy13994         72 KKFGCEYCSA   81 (97)
Q Consensus        72 ~~~~C~~C~~   81 (97)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4799999984


No 74 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=86.12  E-value=0.3  Score=18.12  Aligned_cols=10  Identities=30%  Similarity=0.673  Sum_probs=7.2

Q ss_pred             ccccchhhcc
Q psy13994         75 GCEYCSARFS   84 (97)
Q Consensus        75 ~C~~C~~~f~   84 (97)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4778887774


No 75 
>KOG4167|consensus
Probab=85.82  E-value=0.22  Score=33.40  Aligned_cols=25  Identities=36%  Similarity=0.568  Sum_probs=22.6

Q ss_pred             CcccccchhhccChHHHHHHhhhcC
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLRHR   97 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~h~   97 (97)
                      -|.|.+|+|.|--...+..|+++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4889999999999999999999883


No 76 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.43  E-value=0.27  Score=19.94  Aligned_cols=11  Identities=36%  Similarity=1.044  Sum_probs=9.1

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |+|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            78999998775


No 77 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=84.99  E-value=0.73  Score=26.07  Aligned_cols=56  Identities=14%  Similarity=0.290  Sum_probs=37.4

Q ss_pred             CCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhh----ccChHHHHHH
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSAR----FSQKISCRVH   92 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~----f~~~~~l~~H   92 (97)
                      ..||.|.+|.+.|.++..         ..||-.|.....+...+      +--.|-+||+.    |.-.+.|+.-
T Consensus       194 ~IPF~C~iCKkdy~spvv---------t~CGH~FC~~Cai~~y~------kg~~C~~Cgk~t~G~f~V~~d~~km  253 (259)
T COG5152         194 KIPFLCGICKKDYESPVV---------TECGHSFCSLCAIRKYQ------KGDECGVCGKATYGRFWVVSDLQKM  253 (259)
T ss_pred             CCceeehhchhhccchhh---------hhcchhHHHHHHHHHhc------cCCcceecchhhccceeHHhhHHHH
Confidence            468999999998876543         26888888776665543      23458888874    4445555443


No 78 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=84.90  E-value=0.54  Score=24.82  Aligned_cols=61  Identities=13%  Similarity=0.273  Sum_probs=35.6

Q ss_pred             ccCCCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCc-ccccchhhccChHH
Q psy13994         19 HEGVKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKF-GCEYCSARFSQKIS   88 (97)
Q Consensus        19 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~-~C~~C~~~f~~~~~   88 (97)
                      -.+.+-|+|.+|..+.....-|+     ...-||......-..+-..-.    ..| .||.|..+|...+.
T Consensus        75 F~d~~lYeCnIC~etS~ee~FLK-----PneCCgY~iCn~Cya~LWK~~----~~ypvCPvCkTSFKss~~  136 (140)
T PF05290_consen   75 FLDPKLYECNICKETSAEERFLK-----PNECCGYSICNACYANLWKFC----NLYPVCPVCKTSFKSSSS  136 (140)
T ss_pred             ecCCCceeccCcccccchhhcCC-----cccccchHHHHHHHHHHHHHc----ccCCCCCccccccccccc
Confidence            45567799999998865444332     234566654433222222111    123 49999999987653


No 79 
>KOG2482|consensus
Probab=84.29  E-value=0.64  Score=28.53  Aligned_cols=35  Identities=29%  Similarity=0.622  Sum_probs=26.2

Q ss_pred             HHHHHHHHhccCCCCcccccchhhccChHHHHHHhhh
Q psy13994         59 SVLIAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        59 ~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      ..+..|.....  ..+.|-.|.|.|.....|..||+.
T Consensus       183 nelLehLkekL--~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  183 NELLEHLKEKL--ERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             HHHHHHHHHHH--hhheeeeeccccCCcHHHHHHHHh
Confidence            34444544332  257899999999999999999986


No 80 
>KOG4167|consensus
Probab=84.17  E-value=0.25  Score=33.18  Aligned_cols=25  Identities=36%  Similarity=0.568  Sum_probs=23.1

Q ss_pred             ccccccccccccChHHHHHHHHHcc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      .|.|.+|++.|..-..+..||.+|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999999999999887


No 81 
>KOG2231|consensus
Probab=84.14  E-value=2.1  Score=28.76  Aligned_cols=65  Identities=23%  Similarity=0.534  Sum_probs=34.3

Q ss_pred             ccccccccccChHHHHHHHHHccc---cc------CccccChHHHHHHHHhccCCCCcccc--cch-hhccChHHHHHHh
Q psy13994         26 GCEYCSARFSQKISCRVHMLRHRD---VC------NKPYHRKSVLIAHLQSHEGVKKFGCE--YCS-ARFSQKISCRVHM   93 (97)
Q Consensus        26 ~C~~C~~~f~~~~~l~~h~~~~~~---~c------~~~~~~~~~~~~h~~~h~~~~~~~C~--~C~-~~f~~~~~l~~H~   93 (97)
                      .|..|...|.....|..|++..+.   .|      +..|..-..|..|-+    +.-|.|+  .|. +.|.....+..++
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~~chfC~~~~~~neyy~~~~dLe~HfR----~~HflCE~~~C~~~~f~~~~~~ei~l  259 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHEFCHFCDYKTGQNEYYNDYDDLEEHFR----KGHFLCEEEFCRTKKFYVAFELEIEL  259 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccceeheeecCcccccchhcccchHHHHHhh----hcCccccccccccceeeehhHHHHHH
Confidence            466677777777777777776652   22      223444445555544    3345565  452 3444443444444


Q ss_pred             h
Q psy13994         94 L   94 (97)
Q Consensus        94 ~   94 (97)
                      +
T Consensus       260 k  260 (669)
T KOG2231|consen  260 K  260 (669)
T ss_pred             H
Confidence            4


No 82 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=83.85  E-value=0.1  Score=19.78  Aligned_cols=11  Identities=45%  Similarity=1.026  Sum_probs=8.6

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |.|..|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            46888999884


No 83 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.30  E-value=0.36  Score=20.03  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=9.3

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      |+|..||..|-.
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            789999977753


No 84 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.21  E-value=0.76  Score=23.39  Aligned_cols=14  Identities=21%  Similarity=0.634  Sum_probs=7.9

Q ss_pred             CCcccccchhhccC
Q psy13994         72 KKFGCEYCSARFSQ   85 (97)
Q Consensus        72 ~~~~C~~C~~~f~~   85 (97)
                      .|..|+.||..|.-
T Consensus        25 ~PivCP~CG~~~~~   38 (108)
T PF09538_consen   25 DPIVCPKCGTEFPP   38 (108)
T ss_pred             CCccCCCCCCccCc
Confidence            45556666665543


No 85 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=83.19  E-value=0.84  Score=19.27  Aligned_cols=21  Identities=24%  Similarity=0.376  Sum_probs=17.5

Q ss_pred             cccccchhhccChHHHHHHhh
Q psy13994         74 FGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      |+|-+|..+....+.|.+|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            678888888888888988876


No 86 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=83.11  E-value=2.9  Score=25.99  Aligned_cols=27  Identities=22%  Similarity=0.353  Sum_probs=18.9

Q ss_pred             HhccCCCCcccccch-hhccChHHHHHH
Q psy13994         66 QSHEGVKKFGCEYCS-ARFSQKISCRVH   92 (97)
Q Consensus        66 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H   92 (97)
                      +.|.-++-|.|.+|| +++.-...+.+|
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrH  394 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRH  394 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhh
Confidence            446667789999998 666555555555


No 87 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=82.82  E-value=1  Score=22.76  Aligned_cols=23  Identities=22%  Similarity=0.415  Sum_probs=21.1

Q ss_pred             ccc----ccchhhccChHHHHHHhhhc
Q psy13994         74 FGC----EYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C----~~C~~~f~~~~~l~~H~~~h   96 (97)
                      |.|    ..|+....+...++.|.+.+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHh
Confidence            889    99999999999999998874


No 88 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.67  E-value=0.74  Score=24.32  Aligned_cols=23  Identities=22%  Similarity=0.456  Sum_probs=14.6

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      +.-..|-+||+.|...   .+|++.|
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~   92 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTH   92 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHT
T ss_pred             cCeeEEccCCcccchH---HHHHHHc
Confidence            3446799999998875   7888876


No 89 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=82.57  E-value=0.4  Score=20.75  Aligned_cols=16  Identities=31%  Similarity=0.613  Sum_probs=12.8

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      ++++.|..||..|.-.
T Consensus         2 Dk~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFT   17 (49)
T ss_pred             CeeEEcccCCCeEEEe
Confidence            5778999999988743


No 90 
>KOG0978|consensus
Probab=82.47  E-value=0.62  Score=31.25  Aligned_cols=53  Identities=19%  Similarity=0.464  Sum_probs=31.7

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHH
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCR   90 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~   90 (97)
                      ...|+.|...+....         ...|+-.|.....-...     +-+.-+||.|+.+|...--+.
T Consensus       643 ~LkCs~Cn~R~Kd~v---------I~kC~H~FC~~Cvq~r~-----etRqRKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAV---------ITKCGHVFCEECVQTRY-----ETRQRKCPKCNAAFGANDVHR  695 (698)
T ss_pred             ceeCCCccCchhhHH---------HHhcchHHHHHHHHHHH-----HHhcCCCCCCCCCCCcccccc
Confidence            357899975543222         13688887754332221     123456999999998765443


No 91 
>KOG4124|consensus
Probab=81.77  E-value=0.097  Score=31.92  Aligned_cols=68  Identities=21%  Similarity=0.391  Sum_probs=41.1

Q ss_pred             CCcccccc--ccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccChHHHHH
Q psy13994         22 VKKFGCEY--CSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQKISCRV   91 (97)
Q Consensus        22 ~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~   91 (97)
                      .+|+.|++  |++.......|..|-..  ..|...-.....-.-|...-...|+|+|++|.+.+.....|.-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~--~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLH--GHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeecccc--CcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCc
Confidence            47788854  88888887777655433  2233221111122234444455789999999998886655543


No 92 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=80.82  E-value=0.96  Score=25.95  Aligned_cols=26  Identities=23%  Similarity=0.496  Sum_probs=20.1

Q ss_pred             CCCCcccccchhhccChHHHHHHhhh
Q psy13994         70 GVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      .+..|.|+.|+|-|.-..=...|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            45579999999999998888888765


No 93 
>KOG2785|consensus
Probab=79.94  E-value=7.1  Score=24.55  Aligned_cols=72  Identities=21%  Similarity=0.383  Sum_probs=45.3

Q ss_pred             CCccccccccccccChHHHHHHHHHcccc--cCcc-ccChHHHHHHHHhccCCCCcccccch---hhccChHHHHHHhh
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHRDV--CNKP-YHRKSVLIAHLQSHEGVKKFGCEYCS---ARFSQKISCRVHML   94 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~--c~~~-~~~~~~~~~h~~~h~~~~~~~C~~C~---~~f~~~~~l~~H~~   94 (97)
                      ..|-.|-.|+..+........||..+++.  -... .....-|...+..-.+ .-+.|..|+   +.|......+.|+.
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~-~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVG-IGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhc-cCceEEEeccccCcccccHHHHHHHh
Confidence            45678999999999999999999887721  1110 1112223333333332 345677776   77777777777765


No 94 
>KOG2482|consensus
Probab=79.82  E-value=3.6  Score=25.52  Aligned_cols=25  Identities=32%  Similarity=0.721  Sum_probs=22.1

Q ss_pred             ccccccccccccChHHHHHHHHHcc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      .+.|-.|.+.|..+..|.-||+...
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~  219 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKR  219 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhcc
Confidence            4689999999999999999998754


No 95 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=79.75  E-value=0.59  Score=20.14  Aligned_cols=12  Identities=33%  Similarity=0.966  Sum_probs=8.9

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      |+|..||..|-.
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            678888886653


No 96 
>KOG2186|consensus
Probab=78.98  E-value=1.4  Score=25.88  Aligned_cols=28  Identities=25%  Similarity=0.597  Sum_probs=13.8

Q ss_pred             HHHHhccCCCCcccccchhhccChHHHHHH
Q psy13994         63 AHLQSHEGVKKFGCEYCSARFSQKISCRVH   92 (97)
Q Consensus        63 ~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H   92 (97)
                      .|+..-++ .-|.|..|+++|-. -.+..|
T Consensus        20 kH~srCrn-~~fSCIDC~k~F~~-~sYknH   47 (276)
T KOG2186|consen   20 KHMSRCRN-AYFSCIDCGKTFER-VSYKNH   47 (276)
T ss_pred             HHHHhccC-CeeEEeeccccccc-chhhhh
Confidence            34433333 34566666666665 233444


No 97 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=78.37  E-value=0.99  Score=23.73  Aligned_cols=16  Identities=25%  Similarity=0.904  Sum_probs=13.4

Q ss_pred             CCCCcccccchhhccC
Q psy13994         70 GVKKFGCEYCSARFSQ   85 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~   85 (97)
                      +...|+|+.|+++|..
T Consensus        50 ~~qRyrC~~C~~tf~~   65 (129)
T COG3677          50 GHQRYKCKSCGSTFTV   65 (129)
T ss_pred             cccccccCCcCcceee
Confidence            3568999999999975


No 98 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=77.15  E-value=2.3  Score=17.57  Aligned_cols=24  Identities=21%  Similarity=0.380  Sum_probs=16.7

Q ss_pred             Ccccccchhhcc--ChHHHHHHhhhc
Q psy13994         73 KFGCEYCSARFS--QKISCRVHMLRH   96 (97)
Q Consensus        73 ~~~C~~C~~~f~--~~~~l~~H~~~h   96 (97)
                      ...|+.||-.|.  ....-..|.+-|
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHH
Confidence            357999998777  455666676655


No 99 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=76.91  E-value=0.84  Score=20.27  Aligned_cols=12  Identities=17%  Similarity=0.811  Sum_probs=8.3

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      .|+|..||..|-
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            577777777664


No 100
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=76.41  E-value=1.5  Score=23.50  Aligned_cols=21  Identities=14%  Similarity=0.227  Sum_probs=16.7

Q ss_pred             CcccccchhhccChHHHHHHh
Q psy13994         73 KFGCEYCSARFSQKISCRVHM   93 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~   93 (97)
                      =+.|+.|++.|...+...+-.
T Consensus       124 f~~C~~C~kiyW~GsH~~~~~  144 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWRRME  144 (147)
T ss_pred             EEECCCCCCEecccccHHHHH
Confidence            578999999999887765544


No 101
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=75.58  E-value=1.1  Score=18.25  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=10.8

Q ss_pred             CcccccchhhccC
Q psy13994         73 KFGCEYCSARFSQ   85 (97)
Q Consensus        73 ~~~C~~C~~~f~~   85 (97)
                      |+.|..|++.|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7899999988854


No 102
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=74.82  E-value=0.75  Score=19.13  Aligned_cols=14  Identities=29%  Similarity=0.726  Sum_probs=9.0

Q ss_pred             CCcccccchhhccC
Q psy13994         72 KKFGCEYCSARFSQ   85 (97)
Q Consensus        72 ~~~~C~~C~~~f~~   85 (97)
                      .|+.|+.|++.|-.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            47899999998864


No 103
>KOG2636|consensus
Probab=74.42  E-value=2.7  Score=26.93  Aligned_cols=28  Identities=18%  Similarity=0.411  Sum_probs=22.5

Q ss_pred             HhccCCCCcccccch-hhccChHHHHHHh
Q psy13994         66 QSHEGVKKFGCEYCS-ARFSQKISCRVHM   93 (97)
Q Consensus        66 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~   93 (97)
                      +.|.-...|.|.+|| +++.-...+.+|.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHh
Confidence            457777889999999 7888777887774


No 104
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=73.90  E-value=1.4  Score=19.83  Aligned_cols=11  Identities=18%  Similarity=0.591  Sum_probs=9.0

Q ss_pred             CCCcccccchh
Q psy13994         71 VKKFGCEYCSA   81 (97)
Q Consensus        71 ~~~~~C~~C~~   81 (97)
                      .++|.|+.||-
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            47999999984


No 105
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=73.03  E-value=1.8  Score=21.61  Aligned_cols=19  Identities=26%  Similarity=0.450  Sum_probs=14.5

Q ss_pred             hccCCCccccccccccccCh
Q psy13994         18 SHEGVKKFGCEYCSARFSQK   37 (97)
Q Consensus        18 ~h~~~~~~~C~~C~~~f~~~   37 (97)
                      .+.+ +|.+|.+||..|...
T Consensus        74 l~~g-~~~rC~eCG~~fkL~   92 (97)
T cd00924          74 LEKG-KPKRCPECGHVFKLV   92 (97)
T ss_pred             EeCC-CceeCCCCCcEEEEE
Confidence            3444 799999999988643


No 106
>PLN02294 cytochrome c oxidase subunit Vb
Probab=72.56  E-value=1.9  Score=23.80  Aligned_cols=16  Identities=31%  Similarity=0.706  Sum_probs=13.2

Q ss_pred             CCccccccccccccCh
Q psy13994         22 VKKFGCEYCSARFSQK   37 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~   37 (97)
                      .+|.+|++||..|..+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4689999999998654


No 107
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=72.25  E-value=0.74  Score=20.10  Aligned_cols=26  Identities=19%  Similarity=0.491  Sum_probs=13.1

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ...|+|+.|+..|--.-..-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            35789999998887666655555544


No 108
>KOG2071|consensus
Probab=70.86  E-value=3  Score=27.57  Aligned_cols=26  Identities=27%  Similarity=0.392  Sum_probs=22.9

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      +.|-+|..||..|........|+..|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            45788999999999999999988877


No 109
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=70.83  E-value=1.5  Score=17.30  Aligned_cols=12  Identities=17%  Similarity=0.443  Sum_probs=8.7

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      .|.|..||..+.
T Consensus         2 ~~~C~~CG~i~~   13 (34)
T cd00729           2 VWVCPVCGYIHE   13 (34)
T ss_pred             eEECCCCCCEeE
Confidence            478888887654


No 110
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=70.56  E-value=1.9  Score=24.68  Aligned_cols=20  Identities=30%  Similarity=0.501  Sum_probs=15.6

Q ss_pred             CCccccccccccccChHHHH
Q psy13994         22 VKKFGCEYCSARFSQKISCR   41 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~   41 (97)
                      ++...|++|+..|..+.-..
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CCceECCCCCCeeeeeEEEc
Confidence            45678999999998876543


No 111
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=70.37  E-value=3.4  Score=26.68  Aligned_cols=22  Identities=41%  Similarity=0.770  Sum_probs=19.7

Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            5799999999999999999863


No 112
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=69.32  E-value=1.9  Score=18.59  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=3.8

Q ss_pred             Ccccccchh
Q psy13994         73 KFGCEYCSA   81 (97)
Q Consensus        73 ~~~C~~C~~   81 (97)
                      .|+|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            499999985


No 113
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=68.47  E-value=3.4  Score=16.48  Aligned_cols=12  Identities=33%  Similarity=0.852  Sum_probs=8.3

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      ...+|+.|+..|
T Consensus        24 ~~v~C~~C~~~f   35 (36)
T PF13717_consen   24 RKVRCSKCGHVF   35 (36)
T ss_pred             cEEECCCCCCEe
Confidence            456788887765


No 114
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=68.45  E-value=4.5  Score=17.59  Aligned_cols=14  Identities=14%  Similarity=0.534  Sum_probs=7.8

Q ss_pred             ccccccccccChHH
Q psy13994         26 GCEYCSARFSQKIS   39 (97)
Q Consensus        26 ~C~~C~~~f~~~~~   39 (97)
                      .|++|+..|.....
T Consensus        22 ~CPlC~r~l~~e~~   35 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR   35 (54)
T ss_dssp             E-TTT--EE-HHHH
T ss_pred             cCCCCCCCCCHHHH
Confidence            89999999976643


No 115
>KOG2636|consensus
Probab=68.34  E-value=4.7  Score=25.89  Aligned_cols=30  Identities=17%  Similarity=0.355  Sum_probs=24.4

Q ss_pred             hhccCCCcccccccc-ccccChHHHHHHHHH
Q psy13994         17 QSHEGVKKFGCEYCS-ARFSQKISCRVHMLR   46 (97)
Q Consensus        17 ~~h~~~~~~~C~~C~-~~f~~~~~l~~h~~~   46 (97)
                      +.|.-...|.|.+|| .++.....+..|..-
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhHH
Confidence            446567789999999 888999999988754


No 116
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=68.22  E-value=2.3  Score=19.16  Aligned_cols=11  Identities=18%  Similarity=0.658  Sum_probs=9.0

Q ss_pred             CCCcccccchh
Q psy13994         71 VKKFGCEYCSA   81 (97)
Q Consensus        71 ~~~~~C~~C~~   81 (97)
                      .++|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            36899999984


No 117
>KOG0717|consensus
Probab=68.06  E-value=3.6  Score=26.56  Aligned_cols=23  Identities=17%  Similarity=0.368  Sum_probs=20.7

Q ss_pred             cccccccccccChHHHHHHHHHc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      +.|.+|.++|.+...+..|..+-
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSK  315 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSK  315 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHH
Confidence            88999999999999999998754


No 118
>KOG1813|consensus
Probab=67.75  E-value=4.4  Score=24.56  Aligned_cols=59  Identities=19%  Similarity=0.328  Sum_probs=37.0

Q ss_pred             CCCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchh----hccChHHHHHHhh
Q psy13994         21 GVKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSA----RFSQKISCRVHML   94 (97)
Q Consensus        21 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~----~f~~~~~l~~H~~   94 (97)
                      +..||.|.+|.+.|..+..         ..|+-.|....++..+++      .-.|.+|++    .|.....|..-+.
T Consensus       238 ~~~Pf~c~icr~~f~~pVv---------t~c~h~fc~~ca~~~~qk------~~~c~vC~~~t~g~~~~akeL~~~L~  300 (313)
T KOG1813|consen  238 ELLPFKCFICRKYFYRPVV---------TKCGHYFCEVCALKPYQK------GEKCYVCSQQTHGSFNVAKELLVSLK  300 (313)
T ss_pred             ccCCccccccccccccchh---------hcCCceeehhhhcccccc------CCcceecccccccccchHHHHHHHHH
Confidence            4578999999999866542         267777777666654422      223666654    4555666655544


No 119
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.68  E-value=3.9  Score=21.55  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=6.5

Q ss_pred             cccccccccc
Q psy13994         25 FGCEYCSARF   34 (97)
Q Consensus        25 ~~C~~C~~~f   34 (97)
                      ..|+.||..|
T Consensus        10 r~Cp~cg~kF   19 (129)
T TIGR02300        10 RICPNTGSKF   19 (129)
T ss_pred             ccCCCcCccc
Confidence            4567776666


No 120
>KOG2593|consensus
Probab=67.29  E-value=5.3  Score=25.51  Aligned_cols=21  Identities=14%  Similarity=0.464  Sum_probs=14.8

Q ss_pred             cCCCCcccccchhhccChHHH
Q psy13994         69 EGVKKFGCEYCSARFSQKISC   89 (97)
Q Consensus        69 ~~~~~~~C~~C~~~f~~~~~l   89 (97)
                      ....-|.|+.|.+.|...-.+
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~  144 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEAL  144 (436)
T ss_pred             cccccccCCccccchhhhHHH
Confidence            344568888888888766554


No 121
>PTZ00448 hypothetical protein; Provisional
Probab=66.34  E-value=4.9  Score=25.15  Aligned_cols=23  Identities=13%  Similarity=0.339  Sum_probs=20.4

Q ss_pred             CcccccchhhccChHHHHHHhhh
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      .|.|..|+..|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999988888999875


No 122
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=66.18  E-value=3.3  Score=22.03  Aligned_cols=20  Identities=25%  Similarity=0.398  Sum_probs=15.8

Q ss_pred             cccccchhhccChHHHHHHhhhc
Q psy13994         74 FGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ..|-++||.|.   .|++|+.+|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~   96 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTH   96 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcc
Confidence            46888998885   578888876


No 123
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=65.86  E-value=2.2  Score=18.52  Aligned_cols=11  Identities=18%  Similarity=0.860  Sum_probs=7.8

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |+|..||..|.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            67777777665


No 124
>KOG1842|consensus
Probab=65.05  E-value=4.3  Score=26.06  Aligned_cols=23  Identities=17%  Similarity=0.273  Sum_probs=20.6

Q ss_pred             CcccccchhhccChHHHHHHhhh
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      -|.||+|.+.|.....|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            58899999999999999999754


No 125
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=64.38  E-value=2.4  Score=16.87  Aligned_cols=13  Identities=23%  Similarity=0.690  Sum_probs=6.9

Q ss_pred             ccccchhhccChH
Q psy13994         75 GCEYCSARFSQKI   87 (97)
Q Consensus        75 ~C~~C~~~f~~~~   87 (97)
                      .|..|++.|..+.
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            5889999988653


No 126
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=64.09  E-value=2.6  Score=17.61  Aligned_cols=12  Identities=25%  Similarity=0.675  Sum_probs=9.7

Q ss_pred             ccccchhhccCh
Q psy13994         75 GCEYCSARFSQK   86 (97)
Q Consensus        75 ~C~~C~~~f~~~   86 (97)
                      .|+.|++.|+..
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            399999999754


No 127
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=63.68  E-value=2.5  Score=17.72  Aligned_cols=12  Identities=17%  Similarity=0.747  Sum_probs=6.9

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      .|.|+.||..|.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            456666665543


No 128
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=63.66  E-value=2.1  Score=18.34  Aligned_cols=11  Identities=18%  Similarity=0.827  Sum_probs=7.5

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |+|..|+..|-
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            66777776654


No 129
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=63.46  E-value=6.9  Score=25.38  Aligned_cols=25  Identities=36%  Similarity=0.647  Sum_probs=22.1

Q ss_pred             ccccccccccccChHHHHHHHHHcc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      -+.|+.|++.|.....+..|+...+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhh
Confidence            4789999999999999999998665


No 130
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=63.44  E-value=2.2  Score=23.18  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=11.8

Q ss_pred             CcccccchhhccCh
Q psy13994         73 KFGCEYCSARFSQK   86 (97)
Q Consensus        73 ~~~C~~C~~~f~~~   86 (97)
                      .++|+.||++|...
T Consensus        28 ~~~c~~c~~~f~~~   41 (154)
T PRK00464         28 RRECLACGKRFTTF   41 (154)
T ss_pred             eeeccccCCcceEe
Confidence            48899999999864


No 131
>PF12907 zf-met2:  Zinc-binding
Probab=63.08  E-value=6.8  Score=16.19  Aligned_cols=21  Identities=19%  Similarity=0.418  Sum_probs=15.9

Q ss_pred             cccccchhhcc---ChHHHHHHhh
Q psy13994         74 FGCEYCSARFS---QKISCRVHML   94 (97)
Q Consensus        74 ~~C~~C~~~f~---~~~~l~~H~~   94 (97)
                      +.|.+|.-+|.   ....|.+|-.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHH
Confidence            57999997666   4567888865


No 132
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=60.60  E-value=7.7  Score=23.48  Aligned_cols=25  Identities=32%  Similarity=0.568  Sum_probs=22.2

Q ss_pred             CCCcccccchhhccChHHHHHHhhh
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +..|.|+.|-+-|.....|.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            5679999999999999999999864


No 133
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=60.41  E-value=3.9  Score=21.63  Aligned_cols=27  Identities=19%  Similarity=0.415  Sum_probs=18.1

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNK   53 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~   53 (97)
                      |+.|..||+.|..-+.   .+...-+.||-
T Consensus         1 PH~Ct~Cg~~f~dgs~---eil~GCP~CGg   27 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSK---EILSGCPECGG   27 (131)
T ss_pred             CcccCcCCCCcCCCcH---HHHccCcccCC
Confidence            6789999999976552   14445566663


No 134
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=59.23  E-value=3.6  Score=16.14  Aligned_cols=12  Identities=25%  Similarity=0.689  Sum_probs=8.5

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      -+.|..|+.+|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            356888887764


No 135
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=59.20  E-value=4  Score=20.16  Aligned_cols=14  Identities=21%  Similarity=0.645  Sum_probs=11.7

Q ss_pred             CCcccccchhhccC
Q psy13994         72 KKFGCEYCSARFSQ   85 (97)
Q Consensus        72 ~~~~C~~C~~~f~~   85 (97)
                      +|-+|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            57789999998876


No 136
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=59.06  E-value=10  Score=14.91  Aligned_cols=21  Identities=14%  Similarity=0.298  Sum_probs=12.4

Q ss_pred             ccccccccccccChHHHHHHHH
Q psy13994         24 KFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      .+.|+.|++...... +..|+.
T Consensus         4 ~~~C~nC~R~v~a~R-fA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAASR-FAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEGGG-HHHHHH
T ss_pred             eEECCCCcCCcchhh-hHHHHH
Confidence            467888888765543 455543


No 137
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=58.04  E-value=12  Score=15.18  Aligned_cols=22  Identities=18%  Similarity=0.564  Sum_probs=9.4

Q ss_pred             CcccccchhhccC-h-HHHHHHhh
Q psy13994         73 KFGCEYCSARFSQ-K-ISCRVHML   94 (97)
Q Consensus        73 ~~~C~~C~~~f~~-~-~~l~~H~~   94 (97)
                      .|=|..|+.-|.. . +....|..
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             CeecccccceecCCChHHHHHhhc
Confidence            4679999998843 3 44466643


No 138
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=58.03  E-value=5.4  Score=23.25  Aligned_cols=18  Identities=17%  Similarity=0.222  Sum_probs=14.4

Q ss_pred             CCCccccccccccccChH
Q psy13994         21 GVKKFGCEYCSARFSQKI   38 (97)
Q Consensus        21 ~~~~~~C~~C~~~f~~~~   38 (97)
                      ..++.+|.+||..|....
T Consensus       178 EGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCCccCCCCCcEEEEEE
Confidence            456899999999997644


No 139
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=57.91  E-value=7.6  Score=19.78  Aligned_cols=24  Identities=17%  Similarity=0.202  Sum_probs=19.9

Q ss_pred             CCcccccchhhccChHHHHHHhhh
Q psy13994         72 KKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        72 ~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      ..+-|..|.+-|.+...|..|.+-
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            346688999999999999999763


No 140
>KOG2807|consensus
Probab=57.61  E-value=15  Score=22.84  Aligned_cols=72  Identities=17%  Similarity=0.224  Sum_probs=38.4

Q ss_pred             CccccccccccccChHHHHHHHHHcccccCccccChHHHH--------HHHHhccCCCCcccccchhhccChHHHHHHhh
Q psy13994         23 KKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLI--------AHLQSHEGVKKFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~--------~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      -|.+|++|+-+......|.+-.+.--+.  +.|.......        .-...-.+...|+|..|...|--.-+...|..
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL--~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPL--KPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCC--cchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhh
Confidence            4678888888887777776543321111  1111110000        00011123346899999888887666666655


Q ss_pred             hc
Q psy13994         95 RH   96 (97)
Q Consensus        95 ~h   96 (97)
                      .|
T Consensus       367 Lh  368 (378)
T KOG2807|consen  367 LH  368 (378)
T ss_pred             hh
Confidence            44


No 141
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=55.98  E-value=15  Score=19.75  Aligned_cols=19  Identities=11%  Similarity=0.420  Sum_probs=13.3

Q ss_pred             cCCCccccccccccccChH
Q psy13994         20 EGVKKFGCEYCSARFSQKI   38 (97)
Q Consensus        20 ~~~~~~~C~~C~~~f~~~~   38 (97)
                      .+...|.|+.|+..|....
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLE  113 (147)
T ss_pred             cCCcEEECcCCCCEeeHHH
Confidence            3455689999988876433


No 142
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=55.82  E-value=3.8  Score=17.98  Aligned_cols=27  Identities=26%  Similarity=0.525  Sum_probs=13.9

Q ss_pred             HHHHHHHHhccCCCCccccc----chhhccC
Q psy13994         59 SVLIAHLQSHEGVKKFGCEY----CSARFSQ   85 (97)
Q Consensus        59 ~~~~~h~~~h~~~~~~~C~~----C~~~f~~   85 (97)
                      ..|..|....-..++..|+.    |+..+..
T Consensus        24 ~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen   24 KELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             CCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             HHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            35566666544455667777    7665543


No 143
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=55.39  E-value=37  Score=21.47  Aligned_cols=22  Identities=23%  Similarity=0.439  Sum_probs=12.6

Q ss_pred             cccccccccChHHHHHHHHHcc
Q psy13994         27 CEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        27 C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      |..|...|-....|..|++..+
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhccceecChHHHHHHHHhhh
Confidence            5555555555556666655544


No 144
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=55.17  E-value=3.5  Score=17.00  Aligned_cols=12  Identities=33%  Similarity=1.005  Sum_probs=9.5

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      ++-.|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456799999877


No 145
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=54.88  E-value=9.4  Score=24.68  Aligned_cols=25  Identities=28%  Similarity=0.518  Sum_probs=22.4

Q ss_pred             CCCcccccchhhccChHHHHHHhhh
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +..|.|+.|-+-|.....|..|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            4679999999999999999999864


No 146
>PF14353 CpXC:  CpXC protein
Probab=54.77  E-value=4.5  Score=21.00  Aligned_cols=16  Identities=25%  Similarity=0.704  Sum_probs=12.1

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      -..+.|+.||..|.-.
T Consensus        36 l~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   36 LFSFTCPSCGHKFRLE   51 (128)
T ss_pred             cCEEECCCCCCceecC
Confidence            3468899999987643


No 147
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=54.73  E-value=6.3  Score=19.93  Aligned_cols=27  Identities=19%  Similarity=0.388  Sum_probs=17.4

Q ss_pred             CccccccccccccChHHHHHHHHHcccccC
Q psy13994         23 KKFGCEYCSARFSQKISCRVHMLRHRDVCN   52 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~   52 (97)
                      .|+.|..||..|..-+..   +...-+.||
T Consensus         1 MpH~CtrCG~vf~~g~~~---il~GCp~CG   27 (112)
T COG3364           1 MPHQCTRCGEVFDDGSEE---ILSGCPKCG   27 (112)
T ss_pred             CCceecccccccccccHH---HHccCcccc
Confidence            378899999999875332   233445555


No 148
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=54.58  E-value=3  Score=17.20  Aligned_cols=28  Identities=21%  Similarity=0.496  Sum_probs=10.5

Q ss_pred             ccCccccChHHHHHHHHhccCCCCcccccc
Q psy13994         50 VCNKPYHRKSVLIAHLQSHEGVKKFGCEYC   79 (97)
Q Consensus        50 ~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C   79 (97)
                      .||-.|-..- +........ ...+.|++|
T Consensus        15 ~CGH~FC~~C-l~~~~~~~~-~~~~~CP~C   42 (42)
T PF15227_consen   15 PCGHSFCRSC-LERLWKEPS-GSGFSCPEC   42 (42)
T ss_dssp             SSSSEEEHHH-HHHHHCCSS-SST---SSS
T ss_pred             CCcCHHHHHH-HHHHHHccC-CcCCCCcCC
Confidence            4666665433 222222222 223677765


No 149
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=54.17  E-value=4.7  Score=19.88  Aligned_cols=11  Identities=27%  Similarity=1.035  Sum_probs=7.3

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      ..|.|++|++.
T Consensus        34 ~ky~Cp~Cgk~   44 (90)
T PF01780_consen   34 AKYTCPFCGKT   44 (90)
T ss_dssp             S-BEESSSSSS
T ss_pred             CCCcCCCCCCc
Confidence            36888888764


No 150
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=54.04  E-value=4.7  Score=21.54  Aligned_cols=19  Identities=37%  Similarity=0.656  Sum_probs=14.3

Q ss_pred             hccCCCccccccccccccCh
Q psy13994         18 SHEGVKKFGCEYCSARFSQK   37 (97)
Q Consensus        18 ~h~~~~~~~C~~C~~~f~~~   37 (97)
                      .+.+ +|.+|+.||..|...
T Consensus       107 l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             EETT-SEEEETTTEEEEEEE
T ss_pred             EeCC-CccCCCCCCeEEEEE
Confidence            3444 589999999998654


No 151
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=53.98  E-value=11  Score=20.91  Aligned_cols=21  Identities=14%  Similarity=0.328  Sum_probs=16.0

Q ss_pred             CCcccccchhhccChHHHHHH
Q psy13994         72 KKFGCEYCSARFSQKISCRVH   92 (97)
Q Consensus        72 ~~~~C~~C~~~f~~~~~l~~H   92 (97)
                      .-|.|+.||+.|...+....-
T Consensus       129 ~f~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         129 EFYRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             ceeECCCCcccccCchHHHHH
Confidence            346799999999987776443


No 152
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=53.82  E-value=18  Score=19.80  Aligned_cols=23  Identities=17%  Similarity=0.166  Sum_probs=15.8

Q ss_pred             hccCCCccccccccccccChHHH
Q psy13994         18 SHEGVKKFGCEYCSARFSQKISC   40 (97)
Q Consensus        18 ~h~~~~~~~C~~C~~~f~~~~~l   40 (97)
                      ...+..-|.|+.|+..|+....+
T Consensus       103 ~e~~~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       103 FETNNMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             hccCCCeEECCCCCcEeeHHHHH
Confidence            34455678899898887666554


No 153
>KOG2747|consensus
Probab=53.81  E-value=8.8  Score=24.35  Aligned_cols=26  Identities=23%  Similarity=0.494  Sum_probs=23.0

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ...|.|++|-+-+.....|++|+...
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC  181 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKC  181 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhc
Confidence            56799999999999999999998753


No 154
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=53.54  E-value=4.8  Score=15.95  Aligned_cols=14  Identities=21%  Similarity=0.510  Sum_probs=9.6

Q ss_pred             cccccchhhccChH
Q psy13994         74 FGCEYCSARFSQKI   87 (97)
Q Consensus        74 ~~C~~C~~~f~~~~   87 (97)
                      +.|+.|+..|.-..
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            56888888776443


No 155
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=53.09  E-value=7.6  Score=17.28  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=12.0

Q ss_pred             cCCCCcccccchhhcc
Q psy13994         69 EGVKKFGCEYCSARFS   84 (97)
Q Consensus        69 ~~~~~~~C~~C~~~f~   84 (97)
                      .+...|.|+.||..+-
T Consensus        10 ~~~v~~~Cp~cGipth   25 (55)
T PF13824_consen   10 PAHVNFECPDCGIPTH   25 (55)
T ss_pred             ccccCCcCCCCCCcCc
Confidence            4456899999997554


No 156
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.69  E-value=1.7  Score=29.61  Aligned_cols=46  Identities=15%  Similarity=0.217  Sum_probs=24.6

Q ss_pred             cccccccccccChH---HHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhh
Q psy13994         25 FGCEYCSARFSQKI---SCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSAR   82 (97)
Q Consensus        25 ~~C~~C~~~f~~~~---~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~   82 (97)
                      ..|..||..+..+.   .|.-|+..+.            |.-|.--+....|..|+.||..
T Consensus       436 l~C~~Cg~v~~Cp~Cd~~lt~H~~~~~------------L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNCDSPLTLHKATGQ------------LRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCCCcceEEecCCCe------------eEeCCCCCCCCCCCCCCCCCCC
Confidence            45888887775553   2222222211            1222222344578889999865


No 157
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=52.63  E-value=5.2  Score=16.11  Aligned_cols=12  Identities=25%  Similarity=0.670  Sum_probs=6.5

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      .-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            358999998653


No 158
>PTZ00064 histone acetyltransferase; Provisional
Probab=52.61  E-value=11  Score=24.77  Aligned_cols=26  Identities=27%  Similarity=0.295  Sum_probs=22.7

Q ss_pred             CCCCcccccchhhccChHHHHHHhhh
Q psy13994         70 GVKKFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      -+..|.|+.|-+-|.....|.+|+..
T Consensus       277 ~d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        277 VDTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CCeEEEccchhhhhCCHHHHHHHHhc
Confidence            35679999999999999999999864


No 159
>PLN03239 histone acetyltransferase; Provisional
Probab=51.92  E-value=11  Score=23.52  Aligned_cols=24  Identities=17%  Similarity=0.184  Sum_probs=21.4

Q ss_pred             CCCcccccchhhccChHHHHHHhh
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHML   94 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~   94 (97)
                      +..|.|+.|-+-|.....|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            468999999999999999999975


No 160
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=51.11  E-value=5.5  Score=16.75  Aligned_cols=13  Identities=15%  Similarity=0.345  Sum_probs=8.9

Q ss_pred             CcccccchhhccC
Q psy13994         73 KFGCEYCSARFSQ   85 (97)
Q Consensus        73 ~~~C~~C~~~f~~   85 (97)
                      .|.|..||..|.-
T Consensus         2 ~Y~C~~Cg~~~~~   14 (44)
T smart00659        2 IYICGECGRENEI   14 (44)
T ss_pred             EEECCCCCCEeec
Confidence            3778888876653


No 161
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=50.93  E-value=6.6  Score=19.40  Aligned_cols=11  Identities=27%  Similarity=0.936  Sum_probs=8.1

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      ..|.|++|++.
T Consensus        35 a~y~CpfCgk~   45 (90)
T PTZ00255         35 AKYFCPFCGKH   45 (90)
T ss_pred             CCccCCCCCCC
Confidence            36889998753


No 162
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=49.80  E-value=4.9  Score=16.10  Aligned_cols=11  Identities=18%  Similarity=0.455  Sum_probs=7.2

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      +.|+.||..|-
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            34777777664


No 163
>PLN02748 tRNA dimethylallyltransferase
Probab=49.44  E-value=13  Score=24.18  Aligned_cols=24  Identities=17%  Similarity=0.337  Sum_probs=19.4

Q ss_pred             Cccccccccc-cccChHHHHHHHHH
Q psy13994         23 KKFGCEYCSA-RFSQKISCRVHMLR   46 (97)
Q Consensus        23 ~~~~C~~C~~-~f~~~~~l~~h~~~   46 (97)
                      +.|.|.+|+. ++.....+..|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4578999997 78888888888763


No 164
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=49.40  E-value=1.1  Score=30.24  Aligned_cols=50  Identities=20%  Similarity=0.450  Sum_probs=25.6

Q ss_pred             ccccccccccChHHHHHHHHHcc-------cccCccccChHHHHHHHHhccCCCCcccccchh
Q psy13994         26 GCEYCSARFSQKISCRVHMLRHR-------DVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSA   81 (97)
Q Consensus        26 ~C~~C~~~f~~~~~l~~h~~~~~-------~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~   81 (97)
                      .|..||.+|+--..|.--+...+       +.|.+.+..+.+    ++.|.  .|..|+.||-
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccc----ccccc--ccccCcccCC
Confidence            47788888876655433222111       234444433322    22333  4677888875


No 165
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=48.65  E-value=7.8  Score=19.19  Aligned_cols=10  Identities=30%  Similarity=1.175  Sum_probs=7.1

Q ss_pred             Ccccccchhh
Q psy13994         73 KFGCEYCSAR   82 (97)
Q Consensus        73 ~~~C~~C~~~   82 (97)
                      .|.|++|++.
T Consensus        35 ~y~CpfCgk~   44 (91)
T TIGR00280        35 KYVCPFCGKK   44 (91)
T ss_pred             CccCCCCCCC
Confidence            6778888653


No 166
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=48.60  E-value=6.8  Score=14.96  Aligned_cols=13  Identities=38%  Similarity=1.032  Sum_probs=6.4

Q ss_pred             CCcccccchhhcc
Q psy13994         72 KKFGCEYCSARFS   84 (97)
Q Consensus        72 ~~~~C~~C~~~f~   84 (97)
                      ..|.|+.|+..+-
T Consensus        12 ~kY~Cp~C~~~~C   24 (30)
T PF04438_consen   12 AKYRCPRCGARYC   24 (30)
T ss_dssp             ESEE-TTT--EES
T ss_pred             CEEECCCcCCcee
Confidence            3577888776553


No 167
>PHA02926 zinc finger-like protein; Provisional
Probab=48.53  E-value=17  Score=21.36  Aligned_cols=73  Identities=19%  Similarity=0.202  Sum_probs=35.8

Q ss_pred             HHHHhhccCCCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccC
Q psy13994         13 IAHLQSHEGVKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        13 ~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~   85 (97)
                      ..........+.-.|.+|-.....+..-........+.|+-.|.....-............-.||.|...|..
T Consensus       159 ~~ye~~~~~SkE~eCgICmE~I~eK~~~~eRrFGIL~~CnHsFCl~CIr~Wr~~r~~~~~~rsCPiCR~~f~~  231 (242)
T PHA02926        159 DKYEDVYRVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFRN  231 (242)
T ss_pred             HHHHHHHhccCCCCCccCccccccccccccccccccCCCCchHHHHHHHHHHHhccccCcCCcCCCCcceeee
Confidence            3333334444557799986554322110000111225788888755443333221222234569999877653


No 168
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=48.08  E-value=6.5  Score=23.26  Aligned_cols=52  Identities=19%  Similarity=0.351  Sum_probs=31.7

Q ss_pred             CCccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccC
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~   85 (97)
                      ..+|.|++.+..|.....+     .....||-.|.....-..  .     +...|++|++.|..
T Consensus       111 ~~~~~CPvt~~~~~~~~~f-----v~l~~cG~V~s~~alke~--k-----~~~~Cp~c~~~f~~  162 (260)
T PF04641_consen  111 EGRFICPVTGKEFNGKHKF-----VYLRPCGCVFSEKALKEL--K-----KSKKCPVCGKPFTE  162 (260)
T ss_pred             CceeECCCCCcccCCceeE-----EEEcCCCCEeeHHHHHhh--c-----ccccccccCCcccc
Confidence            4568999988887433211     112468888775433221  1     23459999999874


No 169
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=47.82  E-value=9.2  Score=15.26  Aligned_cols=14  Identities=29%  Similarity=0.631  Sum_probs=9.9

Q ss_pred             CCCcccccchhhcc
Q psy13994         71 VKKFGCEYCSARFS   84 (97)
Q Consensus        71 ~~~~~C~~C~~~f~   84 (97)
                      ....+|+.|+-.|.
T Consensus        23 ~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   23 GRKVRCPKCGHVFR   36 (37)
T ss_pred             CcEEECCCCCcEee
Confidence            34677888887764


No 170
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.59  E-value=9.6  Score=19.58  Aligned_cols=14  Identities=7%  Similarity=0.188  Sum_probs=11.5

Q ss_pred             CCCcccccchhhcc
Q psy13994         71 VKKFGCEYCSARFS   84 (97)
Q Consensus        71 ~~~~~C~~C~~~f~   84 (97)
                      ..|..|+.||++|.
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            46888999999984


No 171
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=47.55  E-value=7.1  Score=17.09  Aligned_cols=18  Identities=22%  Similarity=0.626  Sum_probs=11.6

Q ss_pred             cCCCCcccccchhhccCh
Q psy13994         69 EGVKKFGCEYCSARFSQK   86 (97)
Q Consensus        69 ~~~~~~~C~~C~~~f~~~   86 (97)
                      .....|+|..|++.+...
T Consensus        31 ~~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTTCEEEETTT--EEEHH
T ss_pred             CCCCEEEeeCCCCEeccc
Confidence            345679999999887643


No 172
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.07  E-value=6.7  Score=17.85  Aligned_cols=13  Identities=38%  Similarity=1.002  Sum_probs=9.7

Q ss_pred             CcccccchhhccC
Q psy13994         73 KFGCEYCSARFSQ   85 (97)
Q Consensus        73 ~~~C~~C~~~f~~   85 (97)
                      --.|+.|+..|..
T Consensus        48 ev~CPYC~t~y~l   60 (62)
T COG4391          48 EVVCPYCSTRYRL   60 (62)
T ss_pred             cEecCccccEEEe
Confidence            3569999988763


No 173
>KOG0402|consensus
Probab=46.16  E-value=6.4  Score=19.11  Aligned_cols=10  Identities=30%  Similarity=1.271  Sum_probs=8.5

Q ss_pred             Ccccccchhh
Q psy13994         73 KFGCEYCSAR   82 (97)
Q Consensus        73 ~~~C~~C~~~   82 (97)
                      .|.|++||+.
T Consensus        36 ky~CsfCGK~   45 (92)
T KOG0402|consen   36 KYTCSFCGKK   45 (92)
T ss_pred             hhhhhhcchh
Confidence            5899999974


No 174
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=46.12  E-value=18  Score=20.68  Aligned_cols=54  Identities=15%  Similarity=0.345  Sum_probs=31.9

Q ss_pred             CccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHh----------ccCCCCcccccchhhccC
Q psy13994         23 KKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQS----------HEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~----------h~~~~~~~C~~C~~~f~~   85 (97)
                      ..+.|++|...+...         ....||-.|...-....-...          ....++..|+.|...+..
T Consensus        17 ~~~~CpICld~~~dP---------VvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         17 GDFDCNICLDQVRDP---------VVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CccCCccCCCcCCCc---------EEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            468999998766432         123588877665443322110          112345789999877654


No 175
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=45.91  E-value=23  Score=19.82  Aligned_cols=20  Identities=30%  Similarity=0.476  Sum_probs=14.3

Q ss_pred             cCCCccccccccccccChHH
Q psy13994         20 EGVKKFGCEYCSARFSQKIS   39 (97)
Q Consensus        20 ~~~~~~~C~~C~~~f~~~~~   39 (97)
                      ....-|.|+.|+..|+....
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEA  132 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHH
Confidence            34566889989888766654


No 176
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=45.86  E-value=7.9  Score=15.79  Aligned_cols=13  Identities=15%  Similarity=0.611  Sum_probs=9.3

Q ss_pred             CcccccchhhccC
Q psy13994         73 KFGCEYCSARFSQ   85 (97)
Q Consensus        73 ~~~C~~C~~~f~~   85 (97)
                      -+.|+.||..+..
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            4679999876654


No 177
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=45.85  E-value=6.8  Score=22.31  Aligned_cols=25  Identities=20%  Similarity=0.489  Sum_probs=0.0

Q ss_pred             ccCCCCcccccchh-hccChHHHHHH
Q psy13994         68 HEGVKKFGCEYCSA-RFSQKISCRVH   92 (97)
Q Consensus        68 h~~~~~~~C~~C~~-~f~~~~~l~~H   92 (97)
                      |.-.+.|.|.+||. +|.=...+.+|
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             --------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHh
Confidence            45557899999974 55555555555


No 178
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=45.71  E-value=16  Score=20.45  Aligned_cols=20  Identities=15%  Similarity=0.390  Sum_probs=15.1

Q ss_pred             CCCcccccchhhccChHHHH
Q psy13994         71 VKKFGCEYCSARFSQKISCR   90 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~   90 (97)
                      .....|..||+.|.....+.
T Consensus       112 ~~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        112 FHLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             cccCcCcccCCccCcHhHHH
Confidence            35778999999998665443


No 179
>PRK01343 zinc-binding protein; Provisional
Probab=44.31  E-value=13  Score=16.73  Aligned_cols=12  Identities=17%  Similarity=0.360  Sum_probs=8.7

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            356888888765


No 180
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=44.23  E-value=9.6  Score=18.85  Aligned_cols=11  Identities=27%  Similarity=0.597  Sum_probs=7.7

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      ..|.|++|++.
T Consensus        35 a~y~CpfCgk~   45 (90)
T PRK03976         35 AKHVCPVCGRP   45 (90)
T ss_pred             cCccCCCCCCC
Confidence            36888888653


No 181
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=44.06  E-value=9.8  Score=18.33  Aligned_cols=10  Identities=40%  Similarity=1.175  Sum_probs=3.9

Q ss_pred             CCCcccccch
Q psy13994         71 VKKFGCEYCS   80 (97)
Q Consensus        71 ~~~~~C~~C~   80 (97)
                      ++.|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            4679999998


No 182
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=43.53  E-value=8.8  Score=20.80  Aligned_cols=15  Identities=27%  Similarity=0.516  Sum_probs=11.9

Q ss_pred             CcccccchhhccChH
Q psy13994         73 KFGCEYCSARFSQKI   87 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~   87 (97)
                      .-.|..|++.|++.-
T Consensus        28 RReC~~C~~RFTTyE   42 (147)
T TIGR00244        28 RRECLECHERFTTFE   42 (147)
T ss_pred             cccCCccCCccceee
Confidence            456999999998753


No 183
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=43.14  E-value=10  Score=15.60  Aligned_cols=9  Identities=22%  Similarity=0.955  Sum_probs=5.6

Q ss_pred             cccccchhh
Q psy13994         74 FGCEYCSAR   82 (97)
Q Consensus        74 ~~C~~C~~~   82 (97)
                      |.|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            457777654


No 184
>KOG0320|consensus
Probab=43.02  E-value=7  Score=21.92  Aligned_cols=48  Identities=17%  Similarity=0.463  Sum_probs=29.1

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhcc
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFS   84 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~   84 (97)
                      -|.|++|-..+..+..       ....||-.|.....-. -.     .+.-+|+.|+|...
T Consensus       131 ~~~CPiCl~~~sek~~-------vsTkCGHvFC~~Cik~-al-----k~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  131 TYKCPICLDSVSEKVP-------VSTKCGHVFCSQCIKD-AL-----KNTNKCPTCRKKIT  178 (187)
T ss_pred             ccCCCceecchhhccc-------cccccchhHHHHHHHH-HH-----HhCCCCCCcccccc
Confidence            3899999777655443       2247888887543321 11     23456999997433


No 185
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.96  E-value=8.5  Score=18.37  Aligned_cols=12  Identities=33%  Similarity=1.024  Sum_probs=9.2

Q ss_pred             Ccccccchhhcc
Q psy13994         73 KFGCEYCSARFS   84 (97)
Q Consensus        73 ~~~C~~C~~~f~   84 (97)
                      .|+|..|+..|.
T Consensus        12 ~Y~c~~cg~~~d   23 (82)
T COG2331          12 SYECTECGNRFD   23 (82)
T ss_pred             EEeecccchHHH
Confidence            378999987664


No 186
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=42.94  E-value=8.8  Score=14.96  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=5.1

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            44555555443


No 187
>KOG1729|consensus
Probab=42.88  E-value=15  Score=22.39  Aligned_cols=57  Identities=14%  Similarity=0.187  Sum_probs=31.7

Q ss_pred             CccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCc-ccccchhhc
Q psy13994         23 KKFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKF-GCEYCSARF   83 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~-~C~~C~~~f   83 (97)
                      ..-.|..|+.+..+...-    +.|-..||..|.....-+.........++. .|..|-..+
T Consensus       167 ea~~C~~C~~~~Ftl~~R----RHHCR~CG~ivC~~Cs~n~~~l~~~~~k~~rvC~~CF~el  224 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLSER----RHHCRNCGDIVCAPCSRNRFLLPNLSTKPIRVCDICFEEL  224 (288)
T ss_pred             cceecccCCCccccHHHH----HHHHHhcchHhhhhhhcCcccccccCCCCceecHHHHHHH
Confidence            446899999964444332    223467888777643333222223334444 788886554


No 188
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=42.58  E-value=24  Score=17.47  Aligned_cols=21  Identities=10%  Similarity=0.449  Sum_probs=16.1

Q ss_pred             CccccccccccccChHHHHHH
Q psy13994         23 KKFGCEYCSARFSQKISCRVH   43 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h   43 (97)
                      ....|+.||..+.....+..=
T Consensus        34 Pa~~C~~CGe~y~~dev~~eI   54 (89)
T TIGR03829        34 PSISCSHCGMEYQDDTTVKEI   54 (89)
T ss_pred             CcccccCCCcEeecHHHHHHH
Confidence            347899999999888766543


No 189
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=41.72  E-value=12  Score=16.58  Aligned_cols=13  Identities=31%  Similarity=0.767  Sum_probs=8.6

Q ss_pred             cccccccccccCh
Q psy13994         25 FGCEYCSARFSQK   37 (97)
Q Consensus        25 ~~C~~C~~~f~~~   37 (97)
                      +.|+.||..+.-.
T Consensus         3 ~~CP~CG~~iev~   15 (54)
T TIGR01206         3 FECPDCGAEIELE   15 (54)
T ss_pred             cCCCCCCCEEecC
Confidence            5688887766443


No 190
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=41.06  E-value=19  Score=20.00  Aligned_cols=19  Identities=16%  Similarity=0.413  Sum_probs=14.5

Q ss_pred             CCCcccccchhhccChHHH
Q psy13994         71 VKKFGCEYCSARFSQKISC   89 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l   89 (97)
                      ..++.|..||+.|.....+
T Consensus       112 ~~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        112 FALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             eCcccchhhCCccccHHHH
Confidence            3577899999999866543


No 191
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=40.92  E-value=7.6  Score=15.74  Aligned_cols=10  Identities=30%  Similarity=0.943  Sum_probs=7.0

Q ss_pred             cccccchhhc
Q psy13994         74 FGCEYCSARF   83 (97)
Q Consensus        74 ~~C~~C~~~f   83 (97)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6777777654


No 192
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=40.50  E-value=36  Score=14.81  Aligned_cols=46  Identities=13%  Similarity=0.155  Sum_probs=25.4

Q ss_pred             cccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccC
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~   85 (97)
                      +.|++|+..+....         ...||..|.... +..+...     ...|+.|+..+..
T Consensus         2 ~~Cpi~~~~~~~Pv---------~~~~G~v~~~~~-i~~~~~~-----~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKDPV---------ILPSGQTYERRA-IEKWLLS-----HGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCCCE---------ECCCCCEEeHHH-HHHHHHH-----CCCCCCCcCCCCh
Confidence            45777777765431         124666666443 3334333     1358888876643


No 193
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=40.15  E-value=11  Score=20.61  Aligned_cols=18  Identities=11%  Similarity=0.233  Sum_probs=14.9

Q ss_pred             CCccccccccccccChHH
Q psy13994         22 VKKFGCEYCSARFSQKIS   39 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~   39 (97)
                      +.|..|..||+.|+....
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            578999999999987643


No 194
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=40.05  E-value=15  Score=16.22  Aligned_cols=8  Identities=25%  Similarity=1.007  Sum_probs=4.9

Q ss_pred             cccccchh
Q psy13994         74 FGCEYCSA   81 (97)
Q Consensus        74 ~~C~~C~~   81 (97)
                      ..||+||.
T Consensus         4 kPCPFCG~   11 (61)
T PF14354_consen    4 KPCPFCGS   11 (61)
T ss_pred             cCCCCCCC
Confidence            34777764


No 195
>KOG4727|consensus
Probab=39.50  E-value=17  Score=20.36  Aligned_cols=21  Identities=19%  Similarity=0.513  Sum_probs=18.1

Q ss_pred             CcccccchhhccChHHHHHHh
Q psy13994         73 KFGCEYCSARFSQKISCRVHM   93 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~   93 (97)
                      -|-|.+|+-+|....++..|+
T Consensus        75 GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             ceeeeecceeehhhHHHHHHh
Confidence            477999999999988888875


No 196
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=39.45  E-value=12  Score=20.49  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=11.8

Q ss_pred             CcccccchhhccChH
Q psy13994         73 KFGCEYCSARFSQKI   87 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~   87 (97)
                      .-.|+.|+..|++.-
T Consensus        28 RReC~~C~~RFTTfE   42 (156)
T COG1327          28 RRECLECGERFTTFE   42 (156)
T ss_pred             hhcccccccccchhh
Confidence            456999999998753


No 197
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=39.42  E-value=19  Score=22.00  Aligned_cols=44  Identities=23%  Similarity=0.613  Sum_probs=26.6

Q ss_pred             cccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARF   83 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f   83 (97)
                      ..|.+|...|...-.         ..||-+|.+.     -++.|.++.|+ |+.|...|
T Consensus        26 lrC~IC~~~i~ip~~---------TtCgHtFCsl-----CIR~hL~~qp~-CP~Cr~~~   69 (391)
T COG5432          26 LRCRICDCRISIPCE---------TTCGHTFCSL-----CIRRHLGTQPF-CPVCREDP   69 (391)
T ss_pred             HHhhhhhheeeccee---------cccccchhHH-----HHHHHhcCCCC-CccccccH
Confidence            467777655533221         3677777753     34557777777 88886544


No 198
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=39.25  E-value=30  Score=13.58  Aligned_cols=9  Identities=22%  Similarity=0.722  Sum_probs=5.0

Q ss_pred             CCCcccccc
Q psy13994         71 VKKFGCEYC   79 (97)
Q Consensus        71 ~~~~~C~~C   79 (97)
                      ...+.|+.|
T Consensus        33 ~~~~~CP~C   41 (41)
T PF00097_consen   33 SGSVKCPLC   41 (41)
T ss_dssp             TSSSBTTTT
T ss_pred             cCCccCCcC
Confidence            345557665


No 199
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=39.07  E-value=9.3  Score=15.39  Aligned_cols=15  Identities=27%  Similarity=0.642  Sum_probs=8.7

Q ss_pred             ccccchhhccChHHH
Q psy13994         75 GCEYCSARFSQKISC   89 (97)
Q Consensus        75 ~C~~C~~~f~~~~~l   89 (97)
                      .|+.|++.|-..++.
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            488888888766543


No 200
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=38.93  E-value=5.6  Score=18.74  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=10.0

Q ss_pred             CCCcccc--cchhhccC
Q psy13994         71 VKKFGCE--YCSARFSQ   85 (97)
Q Consensus        71 ~~~~~C~--~C~~~f~~   85 (97)
                      +.-++|.  .||.+|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            4556676  78877764


No 201
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=38.52  E-value=12  Score=15.25  Aligned_cols=11  Identities=27%  Similarity=0.918  Sum_probs=7.9

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |.|..|+..+.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            67888887654


No 202
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=38.44  E-value=12  Score=14.45  Aligned_cols=12  Identities=25%  Similarity=0.753  Sum_probs=9.0

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      +-|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            368999998654


No 203
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=38.42  E-value=12  Score=18.45  Aligned_cols=14  Identities=29%  Similarity=0.790  Sum_probs=10.6

Q ss_pred             CCcccccchhhccC
Q psy13994         72 KKFGCEYCSARFSQ   85 (97)
Q Consensus        72 ~~~~C~~C~~~f~~   85 (97)
                      .-|.|..|+..|.-
T Consensus        52 GIW~C~kCg~~fAG   65 (89)
T COG1997          52 GIWKCRKCGAKFAG   65 (89)
T ss_pred             CeEEcCCCCCeecc
Confidence            46888888888763


No 204
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=38.39  E-value=11  Score=16.71  Aligned_cols=11  Identities=27%  Similarity=0.887  Sum_probs=8.7

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      .+|+.|++.|.
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            46889998885


No 205
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=38.22  E-value=12  Score=14.44  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=8.7

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      +-|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            358899998654


No 206
>PF14369 zf-RING_3:  zinc-finger
Probab=37.81  E-value=13  Score=14.76  Aligned_cols=10  Identities=30%  Similarity=0.883  Sum_probs=8.0

Q ss_pred             ccccchhhcc
Q psy13994         75 GCEYCSARFS   84 (97)
Q Consensus        75 ~C~~C~~~f~   84 (97)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999988775


No 207
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.42  E-value=8.8  Score=16.54  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=9.2

Q ss_pred             ccccchhhccCh
Q psy13994         75 GCEYCSARFSQK   86 (97)
Q Consensus        75 ~C~~C~~~f~~~   86 (97)
                      .|+.|+..|+..
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            489999888753


No 208
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=37.30  E-value=11  Score=21.78  Aligned_cols=25  Identities=16%  Similarity=0.076  Sum_probs=0.0

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      .+...|++||....- ..+..|+++.
T Consensus       166 ~~~~~cPitGe~IP~-~e~~eHmRi~  190 (229)
T PF12230_consen  166 EKMIICPITGEMIPA-DEMDEHMRIE  190 (229)
T ss_dssp             --------------------------
T ss_pred             ccccccccccccccc-cccccccccc
Confidence            345789999987664 4788888763


No 209
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=37.19  E-value=17  Score=15.00  Aligned_cols=9  Identities=22%  Similarity=0.608  Sum_probs=6.8

Q ss_pred             Ccccccchh
Q psy13994         73 KFGCEYCSA   81 (97)
Q Consensus        73 ~~~C~~C~~   81 (97)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            567888984


No 210
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=37.05  E-value=11  Score=21.44  Aligned_cols=16  Identities=25%  Similarity=0.565  Sum_probs=10.5

Q ss_pred             CCccccccccccccCh
Q psy13994         22 VKKFGCEYCSARFSQK   37 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~   37 (97)
                      .++..|.+||..|...
T Consensus         4 ~k~rKCKvCg~~F~P~   19 (189)
T PF05766_consen    4 PKRRKCKVCGEWFVPA   19 (189)
T ss_pred             CCCCcCcccCCccccC
Confidence            3556777777777643


No 211
>KOG1994|consensus
Probab=36.91  E-value=19  Score=21.14  Aligned_cols=22  Identities=14%  Similarity=0.520  Sum_probs=18.8

Q ss_pred             CCCcccccchhhccChHHHHHH
Q psy13994         71 VKKFGCEYCSARFSQKISCRVH   92 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H   92 (97)
                      .-.|-|-+||.-|.+...|..|
T Consensus       237 ~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHh
Confidence            3457899999999999999887


No 212
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=36.62  E-value=9.8  Score=16.51  Aligned_cols=13  Identities=15%  Similarity=0.654  Sum_probs=10.1

Q ss_pred             CCcccccchhhcc
Q psy13994         72 KKFGCEYCSARFS   84 (97)
Q Consensus        72 ~~~~C~~C~~~f~   84 (97)
                      ..|.|..||+.|.
T Consensus         5 ~~Y~C~~Cg~~~~   17 (49)
T COG1996           5 MEYKCARCGREVE   17 (49)
T ss_pred             EEEEhhhcCCeee
Confidence            4588988988874


No 213
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=36.14  E-value=24  Score=22.19  Aligned_cols=26  Identities=19%  Similarity=0.363  Sum_probs=22.6

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      +..|.|+.|-+-|.....|.+|.+..
T Consensus       156 d~vyICefClkY~~s~~~~~rH~~kC  181 (395)
T COG5027         156 DIVYICEFCLKYYGSQTSLVRHRKKC  181 (395)
T ss_pred             ceEEEhhhhHHHhcchhHHHHHHhcC
Confidence            45699999999999999999998753


No 214
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=35.99  E-value=20  Score=13.42  Aligned_cols=8  Identities=25%  Similarity=0.874  Sum_probs=4.0

Q ss_pred             Ccccccch
Q psy13994         73 KFGCEYCS   80 (97)
Q Consensus        73 ~~~C~~C~   80 (97)
                      -|.|..|+
T Consensus        15 ~Y~C~~c~   22 (30)
T PF03107_consen   15 FYHCSECC   22 (30)
T ss_pred             eEEeCCCC
Confidence            35555554


No 215
>KOG3214|consensus
Probab=35.87  E-value=14  Score=18.63  Aligned_cols=15  Identities=27%  Similarity=0.747  Sum_probs=12.4

Q ss_pred             cccccccccccChHH
Q psy13994         25 FGCEYCSARFSQKIS   39 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~   39 (97)
                      ..|.+|+.+|.....
T Consensus        48 ~sC~iC~esFqt~it   62 (109)
T KOG3214|consen   48 ASCRICEESFQTTIT   62 (109)
T ss_pred             eeeeehhhhhccchH
Confidence            579999999987754


No 216
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=35.79  E-value=10  Score=14.52  Aligned_cols=11  Identities=18%  Similarity=0.854  Sum_probs=2.8

Q ss_pred             ccccchhhccC
Q psy13994         75 GCEYCSARFSQ   85 (97)
Q Consensus        75 ~C~~C~~~f~~   85 (97)
                      +|+.|+..+.+
T Consensus         4 ~Cp~C~se~~y   14 (30)
T PF08274_consen    4 KCPLCGSEYTY   14 (30)
T ss_dssp             --TTT-----E
T ss_pred             CCCCCCCccee
Confidence            47788766543


No 217
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=35.60  E-value=13  Score=16.70  Aligned_cols=12  Identities=17%  Similarity=0.487  Sum_probs=5.8

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            469999987654


No 218
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.95  E-value=15  Score=21.66  Aligned_cols=16  Identities=25%  Similarity=0.775  Sum_probs=12.6

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      ++.+.||+|+..|...
T Consensus        17 kk~ieCPvC~tkFkke   32 (267)
T COG1655          17 KKTIECPVCNTKFKKE   32 (267)
T ss_pred             hceeccCcccchhhhh
Confidence            4678899999888643


No 219
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=34.87  E-value=16  Score=17.81  Aligned_cols=12  Identities=25%  Similarity=0.730  Sum_probs=9.3

Q ss_pred             ccccchhhccCh
Q psy13994         75 GCEYCSARFSQK   86 (97)
Q Consensus        75 ~C~~C~~~f~~~   86 (97)
                      +|+.||..|...
T Consensus        10 ~C~~CG~d~~~~   21 (86)
T PF06170_consen   10 RCPHCGLDYSHA   21 (86)
T ss_pred             cccccCCccccC
Confidence            599999887753


No 220
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=34.73  E-value=13  Score=16.57  Aligned_cols=11  Identities=36%  Similarity=0.972  Sum_probs=3.6

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      +.|.|+.||-+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            35889999854


No 221
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=34.22  E-value=36  Score=13.72  Aligned_cols=21  Identities=10%  Similarity=0.070  Sum_probs=15.5

Q ss_pred             CcccccchhhccChHHHHHHh
Q psy13994         73 KFGCEYCSARFSQKISCRVHM   93 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~   93 (97)
                      .+.|+.|+-.+.....|.+-+
T Consensus        19 id~C~~C~G~W~d~~el~~~~   39 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEKLL   39 (41)
T ss_pred             EEECCCCCeEEccHHHHHHHH
Confidence            456889988888887776543


No 222
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=34.09  E-value=12  Score=13.24  Aligned_cols=6  Identities=33%  Similarity=1.226  Sum_probs=3.1

Q ss_pred             cccchh
Q psy13994         76 CEYCSA   81 (97)
Q Consensus        76 C~~C~~   81 (97)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555553


No 223
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=34.01  E-value=17  Score=16.69  Aligned_cols=7  Identities=29%  Similarity=1.179  Sum_probs=3.9

Q ss_pred             cccccch
Q psy13994         74 FGCEYCS   80 (97)
Q Consensus        74 ~~C~~C~   80 (97)
                      |.|+.|+
T Consensus         1 y~C~KCg    7 (64)
T PF09855_consen    1 YKCPKCG    7 (64)
T ss_pred             CCCCCCC
Confidence            4566665


No 224
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=33.76  E-value=17  Score=16.24  Aligned_cols=16  Identities=25%  Similarity=0.729  Sum_probs=10.8

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      ++--.|++|++.|...
T Consensus        37 ~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   37 ERYNGCPFCGTPFEFD   52 (55)
T ss_pred             hhccCCCCCCCcccCC
Confidence            4434589999887643


No 225
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=33.36  E-value=18  Score=14.85  Aligned_cols=11  Identities=27%  Similarity=0.794  Sum_probs=5.2

Q ss_pred             ccccchhhccC
Q psy13994         75 GCEYCSARFSQ   85 (97)
Q Consensus        75 ~C~~C~~~f~~   85 (97)
                      .|.+||+.-..
T Consensus         3 ~CSFCgr~~~~   13 (41)
T PF06689_consen    3 RCSFCGRPESE   13 (41)
T ss_dssp             B-TTT--BTTT
T ss_pred             CccCCCCCHHH
Confidence            48888886543


No 226
>KOG2164|consensus
Probab=33.29  E-value=53  Score=21.84  Aligned_cols=52  Identities=15%  Similarity=0.283  Sum_probs=33.7

Q ss_pred             ccccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccC
Q psy13994         24 KFGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQ   85 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~   85 (97)
                      ...|++|-........         ..||-.|..+..|+--... .-..+-.|+.|...+.-
T Consensus       186 ~~~CPICL~~~~~p~~---------t~CGHiFC~~CiLqy~~~s-~~~~~~~CPiC~s~I~~  237 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVR---------TNCGHIFCGPCILQYWNYS-AIKGPCSCPICRSTITL  237 (513)
T ss_pred             CCcCCcccCCCCcccc---------cccCceeeHHHHHHHHhhh-cccCCccCCchhhhccc
Confidence            6789999555433221         2599999887776544433 44456679999876654


No 227
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=32.26  E-value=24  Score=15.64  Aligned_cols=20  Identities=10%  Similarity=0.401  Sum_probs=14.7

Q ss_pred             CCcccccchhhccChHHHHH
Q psy13994         72 KKFGCEYCSARFSQKISCRV   91 (97)
Q Consensus        72 ~~~~C~~C~~~f~~~~~l~~   91 (97)
                      .-+=|-.||..|.....|..
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hCceeeeeCCccCCHHHHHh
Confidence            33458899998888877754


No 228
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=31.95  E-value=18  Score=15.84  Aligned_cols=10  Identities=30%  Similarity=0.999  Sum_probs=6.5

Q ss_pred             ccccchhhcc
Q psy13994         75 GCEYCSARFS   84 (97)
Q Consensus        75 ~C~~C~~~f~   84 (97)
                      .|+.||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5778876543


No 229
>KOG1088|consensus
Probab=31.71  E-value=20  Score=18.70  Aligned_cols=21  Identities=10%  Similarity=0.034  Sum_probs=16.3

Q ss_pred             HhccCCCCcccccchhhccCh
Q psy13994         66 QSHEGVKKFGCEYCSARFSQK   86 (97)
Q Consensus        66 ~~h~~~~~~~C~~C~~~f~~~   86 (97)
                      .++..|....|+.||..|.-.
T Consensus        91 e~~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   91 EIDVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhhhccceEecCCCCcEeecc
Confidence            346667789999999998743


No 230
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=31.49  E-value=19  Score=14.58  Aligned_cols=16  Identities=25%  Similarity=0.800  Sum_probs=9.7

Q ss_pred             ccCCCCcccccchhhc
Q psy13994         68 HEGVKKFGCEYCSARF   83 (97)
Q Consensus        68 h~~~~~~~C~~C~~~f   83 (97)
                      ..+.+.|.|.+|+...
T Consensus        19 ~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen   19 DDGGKTWICNFCGTKN   34 (40)
T ss_dssp             ETTTTEEEETTT--EE
T ss_pred             cCCCCEEECcCCCCcC
Confidence            3345679999998643


No 231
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=31.39  E-value=20  Score=18.14  Aligned_cols=13  Identities=31%  Similarity=0.636  Sum_probs=9.7

Q ss_pred             CCCcccccchhhc
Q psy13994         71 VKKFGCEYCSARF   83 (97)
Q Consensus        71 ~~~~~C~~C~~~f   83 (97)
                      ++.|.|+.||..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            5678999998643


No 232
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=30.47  E-value=54  Score=16.70  Aligned_cols=23  Identities=9%  Similarity=0.235  Sum_probs=17.2

Q ss_pred             CccccccccccccChHHHHHHHH
Q psy13994         23 KKFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      .-+.|+.||..+........-.+
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~~~   52 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRNSA   52 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHHHH
Confidence            45789999999988876655443


No 233
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=30.47  E-value=39  Score=21.04  Aligned_cols=26  Identities=23%  Similarity=0.589  Sum_probs=20.5

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      ...|+|+.|...|-..-+.-.|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            45799999999998877777776554


No 234
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.11  E-value=24  Score=18.69  Aligned_cols=17  Identities=24%  Similarity=0.378  Sum_probs=13.8

Q ss_pred             CCccccccccccccChH
Q psy13994         22 VKKFGCEYCSARFSQKI   38 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~   38 (97)
                      +.|.-|..||..|....
T Consensus        66 e~psfchncgs~fpwte   82 (160)
T COG4306          66 EPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCcchhhcCCCCCCcHH
Confidence            57788999999997653


No 235
>KOG3362|consensus
Probab=30.05  E-value=15  Score=19.94  Aligned_cols=23  Identities=17%  Similarity=0.515  Sum_probs=14.2

Q ss_pred             CcccccchhhccChHHHHHHhhh
Q psy13994         73 KFGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      +|.|.-||-.+-...-+..|..+
T Consensus       129 ~ysC~~CG~kyCsv~C~~~HneT  151 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNET  151 (156)
T ss_pred             hhHHHhcCCceeechhhhhcccc
Confidence            46666666666666666666543


No 236
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=29.80  E-value=21  Score=15.32  Aligned_cols=8  Identities=50%  Similarity=1.231  Sum_probs=4.2

Q ss_pred             cccchhhc
Q psy13994         76 CEYCSARF   83 (97)
Q Consensus        76 C~~C~~~f   83 (97)
                      |+.||..|
T Consensus         1 CP~Cg~~f    8 (50)
T PF14375_consen    1 CPRCGAPF    8 (50)
T ss_pred             CCCCCCcC
Confidence            45555554


No 237
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=29.50  E-value=23  Score=13.37  Aligned_cols=11  Identities=27%  Similarity=0.767  Sum_probs=7.0

Q ss_pred             Ccccccchhhc
Q psy13994         73 KFGCEYCSARF   83 (97)
Q Consensus        73 ~~~C~~C~~~f   83 (97)
                      =|.|..|++.+
T Consensus        27 Cf~C~~C~~~L   37 (39)
T smart00132       27 CFKCSKCGKPL   37 (39)
T ss_pred             CCCCcccCCcC
Confidence            36677777654


No 238
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=29.25  E-value=32  Score=13.66  Aligned_cols=13  Identities=31%  Similarity=0.866  Sum_probs=7.6

Q ss_pred             Ccccccccccccc
Q psy13994         23 KKFGCEYCSARFS   35 (97)
Q Consensus        23 ~~~~C~~C~~~f~   35 (97)
                      .+..|..||..++
T Consensus        20 ~~isC~~CGPr~~   32 (35)
T PF07503_consen   20 QFISCTNCGPRYS   32 (35)
T ss_dssp             TT--BTTCC-SCC
T ss_pred             cCccCCCCCCCEE
Confidence            4567999998765


No 239
>COG4640 Predicted membrane protein [Function unknown]
Probab=28.95  E-value=36  Score=21.93  Aligned_cols=20  Identities=20%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             CCCCcccccchhhccChHHH
Q psy13994         70 GVKKFGCEYCSARFSQKISC   89 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~~~~l   89 (97)
                      .|..++|++||..|...+..
T Consensus        12 ~Ed~~qC~qCG~~~t~~~sq   31 (465)
T COG4640          12 AEDDVQCTQCGHKFTSRQSQ   31 (465)
T ss_pred             ccccccccccCCcCCchhhh
Confidence            34556699999988876554


No 240
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=28.95  E-value=21  Score=15.08  Aligned_cols=14  Identities=21%  Similarity=0.562  Sum_probs=10.6

Q ss_pred             CCcccccchhhccC
Q psy13994         72 KKFGCEYCSARFSQ   85 (97)
Q Consensus        72 ~~~~C~~C~~~f~~   85 (97)
                      ..+.|+.||..+.-
T Consensus        19 ~~~vC~~Cg~~~~~   32 (52)
T smart00661       19 RRFVCRKCGYEEPI   32 (52)
T ss_pred             CEEECCcCCCeEEC
Confidence            36889999976653


No 241
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=28.90  E-value=5.4  Score=16.02  Aligned_cols=17  Identities=24%  Similarity=0.657  Sum_probs=9.7

Q ss_pred             HHHHhccCCCCcccccc
Q psy13994         63 AHLQSHEGVKKFGCEYC   79 (97)
Q Consensus        63 ~h~~~h~~~~~~~C~~C   79 (97)
                      .|-....|...|.|..|
T Consensus        19 k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   19 KNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eCCCCCCCCEeEecCcC
Confidence            34444455566777766


No 242
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.53  E-value=38  Score=20.95  Aligned_cols=53  Identities=17%  Similarity=0.293  Sum_probs=28.6

Q ss_pred             cccccccccccChHHHHHHHHHcccccCccccChHHHHHHHHhccCCCCcccccchhhccCh
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRKSVLIAHLQSHEGVKKFGCEYCSARFSQK   86 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~   86 (97)
                      +.|++|...-.....+    +.-...||-.|.....-.. .    ...+..|+.|++.+...
T Consensus         4 ~~CP~Ck~~~y~np~~----kl~i~~CGH~~C~sCv~~l-~----~~~~~~CP~C~~~lrk~   56 (309)
T TIGR00570         4 QGCPRCKTTKYRNPSL----KLMVNVCGHTLCESCVDLL-F----VRGSGSCPECDTPLRKN   56 (309)
T ss_pred             CCCCcCCCCCccCccc----ccccCCCCCcccHHHHHHH-h----cCCCCCCCCCCCccchh
Confidence            5799997642222221    1112268877775433222 1    22345799998866544


No 243
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=27.92  E-value=45  Score=18.57  Aligned_cols=23  Identities=22%  Similarity=0.533  Sum_probs=19.1

Q ss_pred             cccccccccccChHHHHHHHHHc
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRH   47 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~   47 (97)
                      |.|..|.........+..|+...
T Consensus         1 F~Cs~CKfrtf~~~ei~~HleS~   23 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLESK   23 (165)
T ss_pred             CccceeeeecccHHHHHHHHccc
Confidence            56899998888889999988754


No 244
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.88  E-value=31  Score=15.97  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=5.2

Q ss_pred             Ccccccchh
Q psy13994         73 KFGCEYCSA   81 (97)
Q Consensus        73 ~~~C~~C~~   81 (97)
                      .++|+.||-
T Consensus         4 ~~kCpKCgn   12 (68)
T COG3478           4 AFKCPKCGN   12 (68)
T ss_pred             cccCCCcCC
Confidence            345777763


No 245
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=27.81  E-value=23  Score=13.18  Aligned_cols=11  Identities=18%  Similarity=0.477  Sum_probs=4.7

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      ..|.|.+|+..
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            46788888643


No 246
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=27.56  E-value=28  Score=17.50  Aligned_cols=13  Identities=31%  Similarity=0.838  Sum_probs=9.4

Q ss_pred             CCCcccccchhhc
Q psy13994         71 VKKFGCEYCSARF   83 (97)
Q Consensus        71 ~~~~~C~~C~~~f   83 (97)
                      .+..+|..||..|
T Consensus        86 ~r~~rC~nCG~~f   98 (98)
T PF10164_consen   86 MRERRCSNCGATF   98 (98)
T ss_pred             cCccccCCCCccC
Confidence            4567788888765


No 247
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=27.54  E-value=10  Score=17.03  Aligned_cols=16  Identities=13%  Similarity=0.169  Sum_probs=11.0

Q ss_pred             CCCcccccchhhccCh
Q psy13994         71 VKKFGCEYCSARFSQK   86 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~   86 (97)
                      ...|.|-.|+..+-..
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4678898888877653


No 248
>KOG4118|consensus
Probab=27.38  E-value=41  Score=15.61  Aligned_cols=22  Identities=14%  Similarity=0.425  Sum_probs=16.9

Q ss_pred             cccccchhhccChHHHHHHhhh
Q psy13994         74 FGCEYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        74 ~~C~~C~~~f~~~~~l~~H~~~   95 (97)
                      |.|.+|.........+.+|...
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~   60 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFEN   60 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhh
Confidence            7799998877777777777654


No 249
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.22  E-value=21  Score=18.94  Aligned_cols=15  Identities=27%  Similarity=0.638  Sum_probs=11.8

Q ss_pred             CCcccccchhhccCh
Q psy13994         72 KKFGCEYCSARFSQK   86 (97)
Q Consensus        72 ~~~~C~~C~~~f~~~   86 (97)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458899999888653


No 250
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.19  E-value=29  Score=17.71  Aligned_cols=13  Identities=23%  Similarity=0.657  Sum_probs=9.8

Q ss_pred             ccccccccccccC
Q psy13994         24 KFGCEYCSARFSQ   36 (97)
Q Consensus        24 ~~~C~~C~~~f~~   36 (97)
                      ...|+.||..|..
T Consensus        49 ~t~CP~Cg~~~e~   61 (115)
T COG1885          49 STSCPKCGEPFES   61 (115)
T ss_pred             cccCCCCCCccce
Confidence            3689999987743


No 251
>KOG1280|consensus
Probab=27.08  E-value=70  Score=20.27  Aligned_cols=27  Identities=22%  Similarity=0.449  Sum_probs=22.5

Q ss_pred             CCccccccccccccChHHHHHHHHHcc
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHMLRHR   48 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~~~~   48 (97)
                      +..|.|+.|+........+..|....+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~H  103 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQH  103 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcC
Confidence            456899999999999999988887665


No 252
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.63  E-value=26  Score=16.17  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=8.1

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      -.|+.|||.-.
T Consensus         8 v~CP~Cgkpv~   18 (65)
T COG3024           8 VPCPTCGKPVV   18 (65)
T ss_pred             ccCCCCCCccc
Confidence            46999998544


No 253
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=26.27  E-value=23  Score=16.20  Aligned_cols=17  Identities=12%  Similarity=0.307  Sum_probs=13.1

Q ss_pred             ccCCCCcccccchhhcc
Q psy13994         68 HEGVKKFGCEYCSARFS   84 (97)
Q Consensus        68 h~~~~~~~C~~C~~~f~   84 (97)
                      +..+....|+.|+..|.
T Consensus        48 ~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   48 EIVEGELICPECGREYP   64 (68)
T ss_dssp             ETTTTEEEETTTTEEEE
T ss_pred             cccCCEEEcCCCCCEEe
Confidence            45566788999998875


No 254
>KOG3352|consensus
Probab=26.05  E-value=33  Score=18.80  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=11.9

Q ss_pred             CCccccccccccccCh
Q psy13994         22 VKKFGCEYCSARFSQK   37 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~   37 (97)
                      .+..+|.+||..|...
T Consensus       131 ge~~rc~eCG~~fkL~  146 (153)
T KOG3352|consen  131 GETQRCPECGHYFKLV  146 (153)
T ss_pred             CCcccCCcccceEEee
Confidence            3467899999888643


No 255
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=25.45  E-value=48  Score=15.10  Aligned_cols=17  Identities=18%  Similarity=0.302  Sum_probs=11.1

Q ss_pred             CccccccccccccChHH
Q psy13994         23 KKFGCEYCSARFSQKIS   39 (97)
Q Consensus        23 ~~~~C~~C~~~f~~~~~   39 (97)
                      .|.+|-.||+....+..
T Consensus         3 iPVRCFTCGkvi~~~~e   19 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNKWE   19 (60)
T ss_dssp             -SSS-STTTSBTCGHHH
T ss_pred             CceecCCCCCChhHhHH
Confidence            36789999988765543


No 256
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=25.44  E-value=64  Score=14.42  Aligned_cols=19  Identities=11%  Similarity=0.212  Sum_probs=13.9

Q ss_pred             ccchhhccChHHHHHHhhh
Q psy13994         77 EYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        77 ~~C~~~f~~~~~l~~H~~~   95 (97)
                      .-||+.|.+..++...+..
T Consensus        31 sP~Gk~~Rs~~ev~~yL~~   49 (62)
T cd00122          31 SPCGKKLRSKPEVARYLEK   49 (62)
T ss_pred             CCCCceecCHHHHHHHHHh
Confidence            3478888888888777654


No 257
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=25.29  E-value=22  Score=17.66  Aligned_cols=12  Identities=17%  Similarity=0.617  Sum_probs=9.3

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      |.|.+|+++-..
T Consensus        69 ~~Ct~Cgkah~~   80 (94)
T COG1631          69 LRCTECGKAHQR   80 (94)
T ss_pred             EEehhhcccccc
Confidence            889999986543


No 258
>COG2879 Uncharacterized small protein [Function unknown]
Probab=25.20  E-value=86  Score=14.46  Aligned_cols=17  Identities=12%  Similarity=0.169  Sum_probs=11.0

Q ss_pred             CchHHHHHHhhccCCCc
Q psy13994          8 RKSVLIAHLQSHEGVKK   24 (97)
Q Consensus         8 ~~~~l~~h~~~h~~~~~   24 (97)
                      +..++..||+.++.++|
T Consensus        24 dYdnYVehmr~~hPd~p   40 (65)
T COG2879          24 DYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             cHHHHHHHHHHhCcCCC
Confidence            44566777877665555


No 259
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=24.91  E-value=21  Score=19.49  Aligned_cols=13  Identities=23%  Similarity=0.802  Sum_probs=10.9

Q ss_pred             CcccccchhhccC
Q psy13994         73 KFGCEYCSARFSQ   85 (97)
Q Consensus        73 ~~~C~~C~~~f~~   85 (97)
                      .|+|..|++.|..
T Consensus       132 ~lrC~YCe~~~~~  144 (150)
T TIGR00240       132 ALRCYYCEKEIEH  144 (150)
T ss_pred             EEEEECCCCEEec
Confidence            5999999998863


No 260
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=24.72  E-value=33  Score=15.74  Aligned_cols=11  Identities=18%  Similarity=0.619  Sum_probs=8.5

Q ss_pred             Ccccccchhhc
Q psy13994         73 KFGCEYCSARF   83 (97)
Q Consensus        73 ~~~C~~C~~~f   83 (97)
                      ...|+.|++..
T Consensus         6 ~v~CP~C~k~~   16 (62)
T PRK00418          6 TVNCPTCGKPV   16 (62)
T ss_pred             cccCCCCCCcc
Confidence            46799999864


No 261
>KOG0562|consensus
Probab=24.33  E-value=56  Score=18.36  Aligned_cols=26  Identities=12%  Similarity=0.192  Sum_probs=19.3

Q ss_pred             CCCcccccchhhccChHHHHHHhhhc
Q psy13994         71 VKKFGCEYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        71 ~~~~~C~~C~~~f~~~~~l~~H~~~h   96 (97)
                      +-+.+|-.|+..-.....|+.|++.+
T Consensus       151 k~dLrC~~Cq~~~~~~~kLK~Hl~~~  176 (184)
T KOG0562|consen  151 KEDLRCWRCQTFGPHFPKLKAHLREE  176 (184)
T ss_pred             ccceeehhhhhcccccHHHHHHHHHH
Confidence            34678999994444788899998763


No 262
>KOG4602|consensus
Probab=24.24  E-value=27  Score=21.00  Aligned_cols=11  Identities=27%  Similarity=0.878  Sum_probs=8.6

Q ss_pred             CCcccccchhh
Q psy13994         72 KKFGCEYCSAR   82 (97)
Q Consensus        72 ~~~~C~~C~~~   82 (97)
                      +.|.|++||-+
T Consensus       267 R~YVCPiCGAT  277 (318)
T KOG4602|consen  267 RSYVCPICGAT  277 (318)
T ss_pred             hhhcCcccccc
Confidence            45999999854


No 263
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=24.23  E-value=27  Score=12.56  Aligned_cols=9  Identities=33%  Similarity=0.670  Sum_probs=5.0

Q ss_pred             ccccccccc
Q psy13994         25 FGCEYCSAR   33 (97)
Q Consensus        25 ~~C~~C~~~   33 (97)
                      --|+.||..
T Consensus        17 ~fC~~CG~~   25 (26)
T PF13248_consen   17 KFCPNCGAK   25 (26)
T ss_pred             ccChhhCCC
Confidence            346666643


No 264
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=24.11  E-value=40  Score=13.72  Aligned_cols=11  Identities=27%  Similarity=0.612  Sum_probs=7.5

Q ss_pred             CCCcccccchh
Q psy13994         71 VKKFGCEYCSA   81 (97)
Q Consensus        71 ~~~~~C~~C~~   81 (97)
                      .+...|++|++
T Consensus        34 ~~~~~CP~C~k   44 (44)
T PF14634_consen   34 GKSVKCPICRK   44 (44)
T ss_pred             CCCCCCcCCCC
Confidence            45667888864


No 265
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=24.06  E-value=30  Score=15.26  Aligned_cols=11  Identities=36%  Similarity=1.050  Sum_probs=7.9

Q ss_pred             CCCcccccchh
Q psy13994         71 VKKFGCEYCSA   81 (97)
Q Consensus        71 ~~~~~C~~C~~   81 (97)
                      +-.|.|+.|+.
T Consensus        42 ~i~y~C~~Cg~   52 (54)
T PF10058_consen   42 EIQYRCPYCGA   52 (54)
T ss_pred             ceEEEcCCCCC
Confidence            34688988874


No 266
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=23.69  E-value=8.9  Score=26.87  Aligned_cols=34  Identities=15%  Similarity=0.106  Sum_probs=20.0

Q ss_pred             cccccccccccChHHHHHHHHHcccccCccccCh
Q psy13994         25 FGCEYCSARFSQKISCRVHMLRHRDVCNKPYHRK   58 (97)
Q Consensus        25 ~~C~~C~~~f~~~~~l~~h~~~~~~~c~~~~~~~   58 (97)
                      -.|..|++.|.........++.|-..||..|...
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~  494 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVF  494 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCcc
Confidence            5699999999765321111222446777766544


No 267
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=23.00  E-value=37  Score=15.33  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=5.5

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      -.|..|++.|..
T Consensus        10 ~~C~~C~~~F~~   21 (69)
T PF01363_consen   10 SNCMICGKKFSL   21 (69)
T ss_dssp             SB-TTT--B-BS
T ss_pred             CcCcCcCCcCCC
Confidence            358889998853


No 268
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.99  E-value=34  Score=17.17  Aligned_cols=14  Identities=29%  Similarity=0.862  Sum_probs=9.8

Q ss_pred             CCCccccccccccc
Q psy13994         21 GVKKFGCEYCSARF   34 (97)
Q Consensus        21 ~~~~~~C~~C~~~f   34 (97)
                      +-+.|+|.+||.+.
T Consensus         3 ~lkewkC~VCg~~i   16 (103)
T COG4847           3 GLKEWKCYVCGGTI   16 (103)
T ss_pred             ccceeeEeeeCCEe
Confidence            34568898887654


No 269
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=22.94  E-value=35  Score=14.44  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=6.1

Q ss_pred             cccccchhh
Q psy13994         74 FGCEYCSAR   82 (97)
Q Consensus        74 ~~C~~C~~~   82 (97)
                      -+|+.||..
T Consensus        12 rkCp~CGt~   20 (44)
T PF14952_consen   12 RKCPKCGTY   20 (44)
T ss_pred             ccCCcCcCc
Confidence            358888753


No 270
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=22.93  E-value=35  Score=12.67  Aligned_cols=7  Identities=29%  Similarity=1.217  Sum_probs=2.7

Q ss_pred             cccchhh
Q psy13994         76 CEYCSAR   82 (97)
Q Consensus        76 C~~C~~~   82 (97)
                      |+.|+..
T Consensus         2 CP~C~s~    8 (28)
T PF03119_consen    2 CPVCGSK    8 (28)
T ss_dssp             -TTT--B
T ss_pred             cCCCCCE
Confidence            7778753


No 271
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=22.85  E-value=33  Score=13.42  Aligned_cols=10  Identities=20%  Similarity=0.840  Sum_probs=7.5

Q ss_pred             cccccccccc
Q psy13994         24 KFGCEYCSAR   33 (97)
Q Consensus        24 ~~~C~~C~~~   33 (97)
                      -|.|..|+..
T Consensus         8 ~Y~C~~C~~~   17 (32)
T PF13696_consen    8 GYVCHRCGQK   17 (32)
T ss_pred             CCEeecCCCC
Confidence            3888888765


No 272
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=21.98  E-value=35  Score=15.43  Aligned_cols=15  Identities=20%  Similarity=0.572  Sum_probs=10.9

Q ss_pred             CCCCcccccchhhcc
Q psy13994         70 GVKKFGCEYCSARFS   84 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~   84 (97)
                      ..+.|.|+.||..+-
T Consensus        43 ~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMD   57 (69)
T ss_pred             ccceEEcCCCCCEEC
Confidence            346788999987654


No 273
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=21.94  E-value=35  Score=13.81  Aligned_cols=11  Identities=36%  Similarity=0.918  Sum_probs=3.4

Q ss_pred             cccchhhccCh
Q psy13994         76 CEYCSARFSQK   86 (97)
Q Consensus        76 C~~C~~~f~~~   86 (97)
                      |..|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            56677665443


No 274
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=21.89  E-value=42  Score=18.32  Aligned_cols=24  Identities=13%  Similarity=0.139  Sum_probs=15.2

Q ss_pred             CCccccccccccccChHHHHHHHH
Q psy13994         22 VKKFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        22 ~~~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      .....|++||.+-..+..+..++.
T Consensus        30 ~glv~CP~Cgs~~V~K~lmAP~v~   53 (148)
T PF06676_consen   30 RGLVSCPVCGSTEVSKALMAPAVA   53 (148)
T ss_pred             cCCccCCCCCCCeEeeecCCCeec
Confidence            345789999877666655444433


No 275
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=21.74  E-value=44  Score=14.47  Aligned_cols=16  Identities=13%  Similarity=0.563  Sum_probs=11.5

Q ss_pred             CcccccchhhccChHH
Q psy13994         73 KFGCEYCSARFSQKIS   88 (97)
Q Consensus        73 ~~~C~~C~~~f~~~~~   88 (97)
                      -++|+.||-.|...-.
T Consensus        28 ~W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVN   43 (55)
T ss_pred             EEECCCCCCeeEccHh
Confidence            3789999887775443


No 276
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=21.60  E-value=52  Score=21.35  Aligned_cols=18  Identities=28%  Similarity=0.693  Sum_probs=13.2

Q ss_pred             cCCCCcccccchhhccCh
Q psy13994         69 EGVKKFGCEYCSARFSQK   86 (97)
Q Consensus        69 ~~~~~~~C~~C~~~f~~~   86 (97)
                      .|.+-|+|+.||..+...
T Consensus       363 ~G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         363 AGRNGFRCKKCGTRARET  380 (421)
T ss_pred             cCCCCcccccccccCCcc
Confidence            344479999999887654


No 277
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=21.44  E-value=36  Score=18.70  Aligned_cols=16  Identities=38%  Similarity=0.887  Sum_probs=12.7

Q ss_pred             CCCCcccccchhhccC
Q psy13994         70 GVKKFGCEYCSARFSQ   85 (97)
Q Consensus        70 ~~~~~~C~~C~~~f~~   85 (97)
                      ....|+|..|++.|..
T Consensus       131 ~~~~~rC~YCe~~~~~  146 (152)
T PRK00893        131 EPIKLRCKYCEKEFSE  146 (152)
T ss_pred             CCCEEEeeCCCCEech
Confidence            4457999999998874


No 278
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=21.25  E-value=32  Score=18.42  Aligned_cols=13  Identities=15%  Similarity=0.465  Sum_probs=9.6

Q ss_pred             cccccchhhccCh
Q psy13994         74 FGCEYCSARFSQK   86 (97)
Q Consensus        74 ~~C~~C~~~f~~~   86 (97)
                      -+|+.||..|-..
T Consensus        30 ~kC~~CG~v~~PP   42 (140)
T COG1545          30 TKCKKCGRVYFPP   42 (140)
T ss_pred             EEcCCCCeEEcCC
Confidence            3699999877544


No 279
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=21.22  E-value=67  Score=14.41  Aligned_cols=12  Identities=25%  Similarity=0.863  Sum_probs=7.7

Q ss_pred             Cccccccccccc
Q psy13994         23 KKFGCEYCSARF   34 (97)
Q Consensus        23 ~~~~C~~C~~~f   34 (97)
                      ..|.|..|....
T Consensus        30 ~tYmC~eC~~RI   41 (56)
T PF09963_consen   30 HTYMCDECKERI   41 (56)
T ss_pred             cceeChhHHHHH
Confidence            347788776543


No 280
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=21.16  E-value=94  Score=13.47  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=8.7

Q ss_pred             CCCCcccccchh
Q psy13994         70 GVKKFGCEYCSA   81 (97)
Q Consensus        70 ~~~~~~C~~C~~   81 (97)
                      ++....|+.||.
T Consensus        43 ~~~i~~Cp~CgR   54 (56)
T PF02591_consen   43 GDEIVFCPNCGR   54 (56)
T ss_pred             CCCeEECcCCCc
Confidence            356677999985


No 281
>PF14149 YhfH:  YhfH-like protein
Probab=21.01  E-value=31  Score=14.03  Aligned_cols=11  Identities=18%  Similarity=0.528  Sum_probs=7.7

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      =.|..||+..-
T Consensus        14 K~C~~CG~~i~   24 (37)
T PF14149_consen   14 KKCTECGKEIE   24 (37)
T ss_pred             cccHHHHHHHH
Confidence            35899997643


No 282
>PHA02998 RNA polymerase subunit; Provisional
Probab=20.95  E-value=41  Score=19.07  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=10.2

Q ss_pred             cccccchhhccCh
Q psy13994         74 FGCEYCSARFSQK   86 (97)
Q Consensus        74 ~~C~~C~~~f~~~   86 (97)
                      |.|..||+.|..+
T Consensus       172 YkC~~CG~~wkpp  184 (195)
T PHA02998        172 HACRDCKKHFKPP  184 (195)
T ss_pred             EEcCCCCCccCCc
Confidence            6899999887753


No 283
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=20.93  E-value=80  Score=15.01  Aligned_cols=19  Identities=11%  Similarity=0.216  Sum_probs=14.0

Q ss_pred             ccchhhccChHHHHHHhhh
Q psy13994         77 EYCSARFSQKISCRVHMLR   95 (97)
Q Consensus        77 ~~C~~~f~~~~~l~~H~~~   95 (97)
                      .-||+.|.+..++...+..
T Consensus        34 sP~GkklRs~~ev~~YL~~   52 (77)
T smart00391       34 SPCGKKLRSKSELARYLHK   52 (77)
T ss_pred             CCCCCeeeCHHHHHHHHHh
Confidence            3488888888888777654


No 284
>KOG2907|consensus
Probab=20.91  E-value=30  Score=17.93  Aligned_cols=12  Identities=25%  Similarity=0.977  Sum_probs=8.9

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      |.|+.|++.|+.
T Consensus       103 YTC~kC~~k~~e  114 (116)
T KOG2907|consen  103 YTCPKCKYKFTE  114 (116)
T ss_pred             EEcCccceeeec
Confidence            678888877764


No 285
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=20.85  E-value=29  Score=19.03  Aligned_cols=14  Identities=36%  Similarity=1.037  Sum_probs=11.5

Q ss_pred             CcccccchhhccCh
Q psy13994         73 KFGCEYCSARFSQK   86 (97)
Q Consensus        73 ~~~C~~C~~~f~~~   86 (97)
                      .++|..|++.|...
T Consensus       135 ~lrC~YCe~~~~~~  148 (153)
T COG1781         135 ALRCKYCEKTFSED  148 (153)
T ss_pred             EEEEEecCcEechh
Confidence            48999999988754


No 286
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=20.85  E-value=48  Score=14.30  Aligned_cols=12  Identities=17%  Similarity=0.545  Sum_probs=8.4

Q ss_pred             CCcccccchhhc
Q psy13994         72 KKFGCEYCSARF   83 (97)
Q Consensus        72 ~~~~C~~C~~~f   83 (97)
                      ..+.|..||.++
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            467788887654


No 287
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=20.73  E-value=88  Score=12.95  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=6.1

Q ss_pred             ccccccccc
Q psy13994         25 FGCEYCSAR   33 (97)
Q Consensus        25 ~~C~~C~~~   33 (97)
                      +.|+.||..
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            668888744


No 288
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=20.71  E-value=78  Score=19.52  Aligned_cols=26  Identities=19%  Similarity=0.433  Sum_probs=20.2

Q ss_pred             cCCCccccccccccccChHHHHHHHH
Q psy13994         20 EGVKKFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        20 ~~~~~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      ++....+|.+||..|.......+|..
T Consensus       271 T~~~~ik~n~c~~~~~~e~~~~~Ha~  296 (306)
T COG5539         271 TASPSIKCNICGTGFVGEKDYYAHAL  296 (306)
T ss_pred             cCCceEEeeccccccchhhHHHHHHH
Confidence            34445789999999998888877754


No 289
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=20.63  E-value=33  Score=17.69  Aligned_cols=11  Identities=27%  Similarity=0.951  Sum_probs=7.9

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |.|..||..+.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            67888877664


No 290
>cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD). The MBD, consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1.
Probab=20.53  E-value=80  Score=15.03  Aligned_cols=20  Identities=10%  Similarity=0.175  Sum_probs=15.4

Q ss_pred             ccchhhccChHHHHHHhhhc
Q psy13994         77 EYCSARFSQKISCRVHMLRH   96 (97)
Q Consensus        77 ~~C~~~f~~~~~l~~H~~~h   96 (97)
                      .-+|+.|....++.+.+..+
T Consensus        32 sP~Gkk~RS~~ev~~yL~~~   51 (77)
T cd01396          32 SPTGKKFRSKVELARYLEKN   51 (77)
T ss_pred             CCCCCEEECHHHHHHHHHhC
Confidence            44788888888888887654


No 291
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=20.47  E-value=84  Score=13.25  Aligned_cols=11  Identities=9%  Similarity=0.024  Sum_probs=6.2

Q ss_pred             hccChHHHHHHh
Q psy13994         82 RFSQKISCRVHM   93 (97)
Q Consensus        82 ~f~~~~~l~~H~   93 (97)
                      .|. ...|.+|-
T Consensus        11 ~Y~-~~~LlqHA   21 (43)
T PF03470_consen   11 DYK-YRELLQHA   21 (43)
T ss_pred             cee-hhHHHHHH
Confidence            355 55666664


No 292
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=20.41  E-value=32  Score=15.06  Aligned_cols=11  Identities=18%  Similarity=1.008  Sum_probs=5.7

Q ss_pred             cccccchhhcc
Q psy13994         74 FGCEYCSARFS   84 (97)
Q Consensus        74 ~~C~~C~~~f~   84 (97)
                      |.|..|+.+|+
T Consensus         8 y~CDLCn~~~p   18 (57)
T PF14445_consen    8 YSCDLCNSSHP   18 (57)
T ss_pred             HhHHhhcccCc
Confidence            45555555544


No 293
>KOG0801|consensus
Probab=20.34  E-value=41  Score=18.76  Aligned_cols=12  Identities=17%  Similarity=0.556  Sum_probs=9.3

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      ++|++|.|.-..
T Consensus       139 ~KCPvC~K~V~s  150 (205)
T KOG0801|consen  139 MKCPVCHKVVPS  150 (205)
T ss_pred             ccCCccccccCC
Confidence            789999986543


No 294
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=20.29  E-value=71  Score=13.87  Aligned_cols=22  Identities=27%  Similarity=0.552  Sum_probs=14.2

Q ss_pred             CCCccccccccccccChHHHHHHHH
Q psy13994         21 GVKKFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        21 ~~~~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      ..+|-.|..|...|.   .|..|+.
T Consensus         2 ~~k~GYCE~Cr~kfd---~l~~Hi~   23 (49)
T smart00586        2 EKKPGYCENCREKYD---DLETHLL   23 (49)
T ss_pred             CCCCcccccHhHHHh---hHHHHhc
Confidence            346677888887775   4555543


No 295
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=20.13  E-value=45  Score=16.35  Aligned_cols=12  Identities=17%  Similarity=0.584  Sum_probs=9.3

Q ss_pred             cccccchhhccC
Q psy13994         74 FGCEYCSARFSQ   85 (97)
Q Consensus        74 ~~C~~C~~~f~~   85 (97)
                      -.|..|++.+..
T Consensus        79 ~~C~vC~k~l~~   90 (109)
T PF10367_consen   79 TKCSVCGKPLGN   90 (109)
T ss_pred             CCccCcCCcCCC
Confidence            359999987765


No 296
>KOG2857|consensus
Probab=20.11  E-value=57  Score=17.76  Aligned_cols=22  Identities=23%  Similarity=0.566  Sum_probs=19.7

Q ss_pred             ccccccccccccChHHHHHHHH
Q psy13994         24 KFGCEYCSARFSQKISCRVHML   45 (97)
Q Consensus        24 ~~~C~~C~~~f~~~~~l~~h~~   45 (97)
                      -|+|+.|...+-+...++.|..
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5999999999999999998876


No 297
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=20.09  E-value=47  Score=14.41  Aligned_cols=14  Identities=21%  Similarity=0.664  Sum_probs=8.8

Q ss_pred             CCCcccccchhhcc
Q psy13994         71 VKKFGCEYCSARFS   84 (97)
Q Consensus        71 ~~~~~C~~C~~~f~   84 (97)
                      .....|+.|+..|-
T Consensus        38 ~~~v~C~~C~~~fC   51 (64)
T smart00647       38 CNRVTCPKCGFSFC   51 (64)
T ss_pred             CCeeECCCCCCeEC
Confidence            34566777776664


Done!