Query         psy1401
Match_columns 79
No_of_seqs    105 out of 198
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 17:14:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1401.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1401hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00198 60S ribosomal protein 100.0 2.2E-50 4.7E-55  278.7   8.6   78    2-79     38-115 (122)
  2 PF01776 Ribosomal_L22e:  Ribos 100.0 2.8E-49   6E-54  269.6   8.1   78    2-79     25-102 (112)
  3 KOG3434|consensus              100.0 1.2E-44 2.6E-49  251.0   5.2   78    2-79     37-114 (125)
  4 PF12970 DUF3858:  Domain of Un  58.2     6.7 0.00015   27.3   1.5   32   11-44     58-89  (116)
  5 PF02747 PCNA_C:  Proliferating  55.7      57  0.0012   21.5   7.7   56   17-76     25-112 (128)
  6 PF13543 KSR1-SAM:  SAM like do  45.1     4.1 8.9E-05   28.5  -1.2   15   57-71     67-81  (129)
  7 KOG2638|consensus               36.7      34 0.00074   29.0   2.7   40   11-53    107-149 (498)
  8 PF08845 SymE_toxin:  Toxin Sym  36.0      55  0.0012   19.7   2.9   18   20-37     40-57  (57)
  9 smart00647 IBR In Between Ring  31.2      47   0.001   18.5   2.0   15   43-57      1-15  (64)
 10 cd02414 jag_KH jag_K homology   30.7 1.3E+02  0.0028   18.2   5.9   50   22-73     15-74  (77)
 11 PHA03383 PCNA-like protein; Pr  30.0 2.3E+02   0.005   21.4   6.0   27   40-70    212-238 (262)
 12 PRK10598 lipoprotein; Provisio  29.5      33 0.00071   25.3   1.4   38    2-39     31-79  (186)
 13 PHA02800 hypothetical protein;  28.7      20 0.00043   26.3   0.1   10   37-46      4-13  (161)
 14 PF05481 Myco_19_kDa:  Mycobact  28.4      71  0.0015   23.0   2.9   31   10-40     52-82  (160)
 15 PF00838 TCTP:  Translationally  28.0      42  0.0009   24.1   1.7   17   39-56     77-94  (165)
 16 PHA02781 hypothetical protein;  26.9      66  0.0014   20.8   2.3   26   10-38      9-34  (78)
 17 PF14651 Lipocalin_7:  Lipocali  26.8 1.1E+02  0.0024   21.0   3.6   39    2-41     14-56  (128)
 18 COG1088 RfbB dTDP-D-glucose 4,  26.8      29 0.00063   28.1   0.8   10   56-65    212-221 (340)
 19 PF07901 DUF1672:  Protein of u  25.7      55  0.0012   25.7   2.1   41    4-44     43-88  (277)
 20 PF01485 IBR:  IBR domain;  Int  24.3      11 0.00024   21.1  -1.5   16   43-58      1-16  (64)
 21 KOG4015|consensus               24.1 1.1E+02  0.0025   21.5   3.3   39    2-41     16-58  (133)
 22 PF09386 ParD:  Antitoxin ParD;  23.7      33 0.00072   22.5   0.5   19    2-21     48-66  (79)
 23 KOG2775|consensus               23.6      48   0.001   27.2   1.4   25   37-61    330-356 (397)
 24 PF04972 BON:  BON domain;  Int  22.7 1.6E+02  0.0034   16.5   3.3   43    8-52      5-49  (64)
 25 PF03526 Microcin:  Colicin E1   22.7      62  0.0013   20.0   1.5   18   39-56     20-37  (55)
 26 PF08490 DUF1744:  Domain of un  21.4 2.7E+02  0.0058   22.4   5.3   47   19-67    329-378 (396)
 27 PF03776 MinE:  Septum formatio  20.3 1.3E+02  0.0028   18.4   2.6   21   23-43     50-70  (70)

No 1  
>PTZ00198 60S ribosomal protein L22; Provisional
Probab=100.00  E-value=2.2e-50  Score=278.74  Aligned_cols=78  Identities=60%  Similarity=1.005  Sum_probs=77.3

Q ss_pred             chHHHhhhhhccCCccCCCCCcEEEEEeCCEEEEEeccccchHHHHHHHHHHhhhccccceeEEEeecCceEEEeecC
Q psy1401           2 DMEKYLLERIKVGGKTSNFGNAVSLERQKTKVILTADVAFSKRYLKYLTKKYLKKNNLRDWLRVVANKKDSYELRYFQ   79 (79)
Q Consensus         2 ~fE~fL~erIKV~gk~gnlg~~V~v~r~k~ki~v~s~~~fsKrYlKYLtKKyLkk~~LrdwlrVva~~K~~YeLrYfn   79 (79)
                      +||+|||||||||||+||||+.|+|++++++|+|+|++|||||||||||||||||++|||||||||++|++|||||||
T Consensus        38 ~fekfL~erIKV~GK~gnLg~~V~v~~~k~ki~V~s~~~FSKRYLKYLTKKyLKK~~LRDwlRVVA~~K~~YELRYfn  115 (122)
T PTZ00198         38 GFEQFLQDRIKVDGKTGNLGNKVRVSREKNKITVTTTIPFSKRYLKYLTKKYLKKKQLRDFLRVVATGKGTYELKYFN  115 (122)
T ss_pred             HHHHHHHHhEEECCCcCccCCcEEEEEECCEEEEEecccccHHHHHHHHHHHHhhhhhhheEEEEecCCCeEEEEEEE
Confidence            699999999999999999999999999999999999999999999999999999999999999999999999999997


No 2  
>PF01776 Ribosomal_L22e:  Ribosomal L22e protein family;  InterPro: IPR002671 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L22e forms part of the 60S ribosomal subunit []. This family is found in eukaryotes. Rattus norvegicus (Rat) L22 is related to ribosomal proteins from other eukaryotes and is identical in amino acid sequence to human EAP, the EBER 1 (Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) encoded RNA) associated protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1D_M 4A1B_M 4A19_M 4A18_M 3IZR_W 3IZS_W.
Probab=100.00  E-value=2.8e-49  Score=269.63  Aligned_cols=78  Identities=72%  Similarity=1.166  Sum_probs=73.5

Q ss_pred             chHHHhhhhhccCCccCCCCCcEEEEEeCCEEEEEeccccchHHHHHHHHHHhhhccccceeEEEeecCceEEEeecC
Q psy1401           2 DMEKYLLERIKVGGKTSNFGNAVSLERQKTKVILTADVAFSKRYLKYLTKKYLKKNNLRDWLRVVANKKDSYELRYFQ   79 (79)
Q Consensus         2 ~fE~fL~erIKV~gk~gnlg~~V~v~r~k~ki~v~s~~~fsKrYlKYLtKKyLkk~~LrdwlrVva~~K~~YeLrYfn   79 (79)
                      +||+||||||||||++||||+.|+|++++++|+|+|++|||||||||||||||||++|||||||||++|++|||||||
T Consensus        25 ~fe~fL~erIKV~gk~gnlg~~V~i~~~~~ki~V~s~v~fsKrYLKYLTKKyLKK~~LRdwlrVva~~K~~YeLrYfn  102 (112)
T PF01776_consen   25 DFEKFLQERIKVNGKTGNLGNKVTISRDKNKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVASSKDTYELRYFN  102 (112)
T ss_dssp             HHHHHHHHHHHHHSCSSSSTTTEEEEE-SSEEEEEESSS-SHHHHHHHHHHHHTTSSSTTTEEECCSCSTCEEEEE--
T ss_pred             HHHHHHHHheEeCCcccccCCeEEEEecCCEEEEEecccccHHHHHHHHHHHHhhcchhheEEEEEcCCCeEEEEEEe
Confidence            699999999999999999999999999999999999999999999999999999999999999999999999999997


No 3  
>KOG3434|consensus
Probab=100.00  E-value=1.2e-44  Score=250.98  Aligned_cols=78  Identities=71%  Similarity=1.149  Sum_probs=76.9

Q ss_pred             chHHHhhhhhccCCccCCCCCcEEEEEeCCEEEEEeccccchHHHHHHHHHHhhhccccceeEEEeecCceEEEeecC
Q psy1401           2 DMEKYLLERIKVGGKTSNFGNAVSLERQKTKVILTADVAFSKRYLKYLTKKYLKKNNLRDWLRVVANKKDSYELRYFQ   79 (79)
Q Consensus         2 ~fE~fL~erIKV~gk~gnlg~~V~v~r~k~ki~v~s~~~fsKrYlKYLtKKyLkk~~LrdwlrVva~~K~~YeLrYfn   79 (79)
                      +||||||||||||||+||||+.|+|++.+++|+|+|++|||+||||||||||||+++|||||||||+++++|||||||
T Consensus        37 ~fe~fLqerIKv~GK~gnLg~vv~ie~~kskitV~s~~~Fs~rylKyltkkYLkk~~LRdwlrvva~~k~~yelryf~  114 (125)
T KOG3434|consen   37 DLEKFLQERIKVNGKVGNLGNVVTIERSKSKITVVSTVHFSKRYLKYLTKKYLKKNNLRDWLRVVATDKNTYELRYFQ  114 (125)
T ss_pred             HHHHHHHHHhhhcccccccCCeEEEecCCcEEEEEecCCccHHHHHHHHHHHHhhhhHHHHHHHhhccCceEEEEecc
Confidence            799999999999999999999999999999999999999999999999999999999999999999999999999997


No 4  
>PF12970 DUF3858:  Domain of Unknown Function with PDB structure (DUF3858);  InterPro: IPR024544 This domain of unknown function is structurally similar to part of neuropilin-2. The proteins it occurs in have not yet been functionally characterised.; PDB: 3KD4_A.
Probab=58.19  E-value=6.7  Score=27.32  Aligned_cols=32  Identities=16%  Similarity=0.335  Sum_probs=25.3

Q ss_pred             hccCCccCCCCCcEEEEEeCCEEEEEeccccchH
Q psy1401          11 IKVGGKTSNFGNAVSLERQKTKVILTADVAFSKR   44 (79)
Q Consensus        11 IKV~gk~gnlg~~V~v~r~k~ki~v~s~~~fsKr   44 (79)
                      .++++..|.+  .|+|..+++++.|+.++..+|+
T Consensus        58 K~I~N~~Gk~--~isv~~~~~~~~V~rsL~L~Kq   89 (116)
T PF12970_consen   58 KKIDNPVGKV--SISVKPEGNKIKVTRSLELKKQ   89 (116)
T ss_dssp             EEEEETTEEE--EEEEEEETTEEEEEEEEEE--S
T ss_pred             eeccCCcceE--EEEEEecCCeEEEEEEEEEeee
Confidence            4667777777  7889999999999999998885


No 5  
>PF02747 PCNA_C:  Proliferating cell nuclear antigen, C-terminal domain;  InterPro: IPR022649 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication []. It acts as a co-factor for DNA polymerase delta, which is responsible for leading strand DNA replication []. The sequence of PCNA is well conserved between plants and animals, indicating a strong selective pressure for structure conservation, and suggesting that this type of DNA replication mechanism is conserved throughout eukaryotes []. In Saccharomyces cerevisiae (Baker's yeast), POL30, is associated with polymerase III, the yeast analog of polymerase delta. Homologues of PCNA have also been identified in the archaea (Euryarchaeota and Crenarchaeota) and in Paramecium bursaria Chlorella virus 1 (PBCV-1) and in nuclear polyhedrosis viruses. ; GO: 0003677 DNA binding, 0030337 DNA polymerase processivity factor activity, 0006275 regulation of DNA replication, 0043626 PCNA complex; PDB: 1IZ5_A 1IZ4_A 1GE8_A 1ISQ_A 3A2F_B 1RWZ_A 3P83_A 1RXM_A 1RXZ_A 1SXJ_F ....
Probab=55.67  E-value=57  Score=21.52  Aligned_cols=56  Identities=27%  Similarity=0.411  Sum_probs=34.2

Q ss_pred             cCCCCCcEEEEEeCCEEEEEec----------------------------c----ccchHHHHHHHHHHhhhccccceeE
Q psy1401          17 TSNFGNAVSLERQKTKVILTAD----------------------------V----AFSKRYLKYLTKKYLKKNNLRDWLR   64 (79)
Q Consensus        17 ~gnlg~~V~v~r~k~ki~v~s~----------------------------~----~fsKrYlKYLtKKyLkk~~Lrdwlr   64 (79)
                      ...+|+.|+|+.+++.+.+.++                            -    .||=+||+.    |.|..+|.|-+.
T Consensus        25 l~~v~d~v~i~~~~~~~~f~~~Gd~~~~~v~~~~~~~~~~~~~~~~i~~~~~~~~~fsl~YL~~----~~Ka~~ls~~V~  100 (128)
T PF02747_consen   25 LSSVGDTVTISADKDSVIFSAEGDIGSAEVEFKETESSEDDEELIEIEVKEPVSSSFSLDYLND----FSKAAPLSDEVT  100 (128)
T ss_dssp             HHTTCSEEEEEEETTEEEEEEEESSEEEEEEEEEEEEETTCTCESEEEESSEEEEEEEHHHHHH----HGGGGGTTSEEE
T ss_pred             HHhcCCEEEEEEeCCEEEEEEEeccCcEEEEEeeccccccccccceeeeccceeeEEeHHHHHh----hhccccCCceEE
Confidence            4456777777777776655333                            1    255566544    566788888887


Q ss_pred             EEeecCceEEEe
Q psy1401          65 VVANKKDSYELR   76 (79)
Q Consensus        65 Vva~~K~~YeLr   76 (79)
                      +--++.---.|+
T Consensus       101 l~l~~~~Pl~l~  112 (128)
T PF02747_consen  101 LELGEDMPLKLE  112 (128)
T ss_dssp             EEEETTSEEEEE
T ss_pred             EEEcCCCCEEEE
Confidence            766665443333


No 6  
>PF13543 KSR1-SAM:  SAM like domain present in kinase suppressor RAS 1
Probab=45.06  E-value=4.1  Score=28.53  Aligned_cols=15  Identities=47%  Similarity=0.924  Sum_probs=11.7

Q ss_pred             ccccceeEEEeecCc
Q psy1401          57 NNLRDWLRVVANKKD   71 (79)
Q Consensus        57 ~~LrdwlrVva~~K~   71 (79)
                      +.|++|||||--+++
T Consensus        67 P~l~~WL~vVgl~~~   81 (129)
T PF13543_consen   67 PSLRQWLRVVGLRPE   81 (129)
T ss_pred             CcHHHHhhhcCCCHH
Confidence            679999999965543


No 7  
>KOG2638|consensus
Probab=36.72  E-value=34  Score=28.97  Aligned_cols=40  Identities=20%  Similarity=0.414  Sum_probs=24.9

Q ss_pred             hccCCccCCCCCcEEEEEeCCEEEEEecccc---chHHHHHHHHHH
Q psy1401          11 IKVGGKTSNFGNAVSLERQKTKVILTADVAF---SKRYLKYLTKKY   53 (79)
Q Consensus        11 IKV~gk~gnlg~~V~v~r~k~ki~v~s~~~f---sKrYlKYLtKKy   53 (79)
                      +|.||..|.   ..-+..-|+-|.|..+..|   +=|-+.||-++|
T Consensus       107 lKLNGGlGt---tmGc~gPKS~ieVR~g~tFLDL~V~QIe~LN~~Y  149 (498)
T KOG2638|consen  107 LKLNGGLGT---TMGCKGPKSVIEVRDGLTFLDLTVRQIENLNKTY  149 (498)
T ss_pred             EEecCCcCC---ccccCCCceeEEEcCCCchhHHHHHHHHHHHhhc
Confidence            566766665   3334445667788777665   667777775444


No 8  
>PF08845 SymE_toxin:  Toxin SymE, type I toxin-antitoxin system;  InterPro: IPR014944 This entry represents a SOS-induced gene whose product shows homology to the antitoxin MazE (SymE), the coding region contains a cis-encoded antisense RNA. The small antisense RNA and the gene have the all the hallmarks of a toxin-antitoxin module. The synthesis of the SymE is tightly repressed at multiple levels; at the transcriptional level by the LexA repressor, at the level of mRNA stability and translation by the SymR RNA and at the level of protein stability by the Lon protease. SymE co-purifies with ribosomes and overproduction of the protein leads to cell growth inhibition, decreased protein synthesis and increased RNA degradation. These properties are shared with several RNA endonuclease toxins of toxin-antitoxin modules. It seems probable that the SymE protein represents an evolutionary derivative of a toxin containing the AbrB fold, whose representatives are typically antitoxins. The SymE promoted cleavage of RNA cleavage may be important for the recycling of RNAs damaged under SOS-inducing conditions []. ; GO: 0003723 RNA binding, 0016788 hydrolase activity, acting on ester bonds, 0016070 RNA metabolic process, 0005737 cytoplasm
Probab=36.00  E-value=55  Score=19.68  Aligned_cols=18  Identities=17%  Similarity=0.349  Sum_probs=15.5

Q ss_pred             CCCcEEEEEeCCEEEEEe
Q psy1401          20 FGNAVSLERQKTKVILTA   37 (79)
Q Consensus        20 lg~~V~v~r~k~ki~v~s   37 (79)
                      -|+.|+|+...++|++++
T Consensus        40 ~G~~v~V~v~~g~lvIt~   57 (57)
T PF08845_consen   40 IGDPVKVRVMPGCLVITP   57 (57)
T ss_pred             CCCEEEEEEECCEEEEeC
Confidence            578999999999999874


No 9  
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=31.17  E-value=47  Score=18.53  Aligned_cols=15  Identities=27%  Similarity=0.674  Sum_probs=12.9

Q ss_pred             hHHHHHHHHHHhhhc
Q psy1401          43 KRYLKYLTKKYLKKN   57 (79)
Q Consensus        43 KrYlKYLtKKyLkk~   57 (79)
                      .||.++|++.|+..+
T Consensus         1 ~~y~~~~~~~~i~~~   15 (64)
T smart00647        1 EKYERLLLESYVESN   15 (64)
T ss_pred             ChHHHHHHHHHHhcC
Confidence            389999999999875


No 10 
>cd02414 jag_KH jag_K homology RNA-binding domain. The KH domain is found in proteins homologous to the Bacillus subtilis protein Jag, which is associated with SpoIIIJ and is necessary for the third stage of sporulation.  The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=30.70  E-value=1.3e+02  Score=18.22  Aligned_cols=50  Identities=24%  Similarity=0.424  Sum_probs=32.6

Q ss_pred             CcEEEEEeCCEEEEEecccc-----chH-----HHHHHHHHHhhhccccceeEEEeecCceE
Q psy1401          22 NAVSLERQKTKVILTADVAF-----SKR-----YLKYLTKKYLKKNNLRDWLRVVANKKDSY   73 (79)
Q Consensus        22 ~~V~v~r~k~ki~v~s~~~f-----sKr-----YlKYLtKKyLkk~~LrdwlrVva~~K~~Y   73 (79)
                      ..|.+..+...+.++-+.+=     .|+     -|.||+..++.++. .++.||+..- +.|
T Consensus        15 ~~v~~~~~~~~i~i~i~~~~~g~LIGk~G~tL~AlQ~L~~~~~~~~~-~~~~~v~lDv-~~Y   74 (77)
T cd02414          15 ADVDVEEEGDTVEVNISGDDIGLLIGKRGKTLDALQYLANLVLNRNT-GEYVRITLDV-EGY   74 (77)
T ss_pred             cEEEEEecCCEEEEEEecCCCCeEECCCCccHHHHHHHHHHHHhhcc-CCceEEEEEC-ccc
Confidence            35666665655554443332     232     48999999999875 8899998765 444


No 11 
>PHA03383 PCNA-like protein; Provisional
Probab=30.02  E-value=2.3e+02  Score=21.36  Aligned_cols=27  Identities=22%  Similarity=0.407  Sum_probs=17.2

Q ss_pred             ccchHHHHHHHHHHhhhccccceeEEEeecC
Q psy1401          40 AFSKRYLKYLTKKYLKKNNLRDWLRVVANKK   70 (79)
Q Consensus        40 ~fsKrYlKYLtKKyLkk~~LrdwlrVva~~K   70 (79)
                      .||=+||+..+    |-..|.|-+.+--++.
T Consensus       212 ~ysl~YL~~~~----Ka~~ls~~V~i~l~~d  238 (262)
T PHA03383        212 KFSLKYLTSFT----KASGMSSSVEIYLKES  238 (262)
T ss_pred             EEeHHHHHHhh----ccccCCCeEEEEEcCC
Confidence            46777776555    4567777766655544


No 12 
>PRK10598 lipoprotein; Provisional
Probab=29.53  E-value=33  Score=25.30  Aligned_cols=38  Identities=26%  Similarity=0.429  Sum_probs=26.6

Q ss_pred             chHHHhhhhhccCCccCCCC---------C-cEEEEEeC-CEEEEEecc
Q psy1401           2 DMEKYLLERIKVGGKTSNFG---------N-AVSLERQK-TKVILTADV   39 (79)
Q Consensus         2 ~fE~fL~erIKV~gk~gnlg---------~-~V~v~r~k-~ki~v~s~~   39 (79)
                      +.++||++++.+.-+.|--|         + .++|.|+. ++|+|++..
T Consensus        31 Ein~yL~k~~~~~k~~G~~gl~~a~i~l~~l~~~IGr~~~~~v~l~g~a   79 (186)
T PRK10598         31 EINQYLAKHNNFEKQIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDA   79 (186)
T ss_pred             HHHHHHHHhccHHHhcCCCceeeeEEEeeeceeecCCCCCCEEEEecee
Confidence            35789999988877777222         1 46777765 788888744


No 13 
>PHA02800 hypothetical protein; Provisional
Probab=28.72  E-value=20  Score=26.34  Aligned_cols=10  Identities=50%  Similarity=0.982  Sum_probs=8.3

Q ss_pred             eccccchHHH
Q psy1401          37 ADVAFSKRYL   46 (79)
Q Consensus        37 s~~~fsKrYl   46 (79)
                      .+.||||||+
T Consensus         4 ~~~~~~~~~~   13 (161)
T PHA02800          4 NTLPFSKRYI   13 (161)
T ss_pred             CCCCcchhhc
Confidence            4579999987


No 14 
>PF05481 Myco_19_kDa:  Mycobacterium 19 kDa lipoprotein antigen;  InterPro: IPR008691 Most of the antigens of Mycobacterium leprae and Mycobacterium tuberculosis that have been identified are members of stress protein families, which are highly conserved throughout many diverse species. Of the M. leprae and M. tuberculosis antigens identified by monoclonal antibodies, all except the 18 kDa M. leprae antigen and the 19 kDa M. tuberculosis antigen are strongly cross-reactive between these two species and are coded within very similar genes [, ].; GO: 0016020 membrane
Probab=28.38  E-value=71  Score=22.99  Aligned_cols=31  Identities=23%  Similarity=0.331  Sum_probs=26.3

Q ss_pred             hhccCCccCCCCCcEEEEEeCCEEEEEeccc
Q psy1401          10 RIKVGGKTSNFGNAVSLERQKTKVILTADVA   40 (79)
Q Consensus        10 rIKV~gk~gnlg~~V~v~r~k~ki~v~s~~~   40 (79)
                      ++.|||+.-+..+.|+.+.....++|...-.
T Consensus        52 ~VtVdG~~~~~~~~V~C~~~~g~~~I~ig~~   82 (160)
T PF05481_consen   52 KVTVDGKDQNVTGPVTCSQTGGKTTIAIGDA   82 (160)
T ss_pred             EEEECCCccCCCcCeEEeecCCEEEEEeCCC
Confidence            6899999999888999999999988876543


No 15 
>PF00838 TCTP:  Translationally controlled tumour protein;  InterPro: IPR018105 Mammalian translationally controlled tumour protein (TCTP) (or P23) is a protein which has been found to be preferentially synthesised in cells during the early growth phase of some types of tumour [, ], but which is also expressed in normal cells. The physiological function of TCTP is still not known. It was first identified as a histamine-releasing factor, acting in IgE +-dependent allergic reactions. In addition, TCTP has been shown to bind to tubulin in the cytoskeleton, has a high affinity for calcium, is the binding target for the antimalarial compound artemisinin, and is induced in vitamin D-dependent apoptosis. TCTP production is thought to be controlled at the translational as well as the transcriptional level [].   TCTP is a hydrophilic protein of 18 to 20 kD. TCTPs do not share significant sequence similarity with any other class of proteins. Recently, the structure of TCTP was determined and exhibited significant structural similarity to the human protein Mss4, which is a guanine nucleotide-free chaperone of the Rab protein []. Close homologues have been found in plants [], earthworm [], Caenorhabditis elegans (F52H2.11), Hydra, Saccharomyces cerevisiae (YKL056c) [] and Schizosaccharomyces pombe (SpAC1F12.02c).; PDB: 2KWB_A 2LOY_A 1TXJ_A 1H6Q_A 1H7Y_A 3P3K_A 1YZ1_C 3EBM_D 2HR9_A.
Probab=28.02  E-value=42  Score=24.05  Aligned_cols=17  Identities=47%  Similarity=0.944  Sum_probs=12.8

Q ss_pred             cccch-HHHHHHHHHHhhh
Q psy1401          39 VAFSK-RYLKYLTKKYLKK   56 (79)
Q Consensus        39 ~~fsK-rYlKYLtKKyLkk   56 (79)
                      .+|+| .|.+|+ |.|+|+
T Consensus        77 t~f~Kk~y~~yi-K~Y~K~   94 (165)
T PF00838_consen   77 TSFDKKSYKAYI-KDYMKK   94 (165)
T ss_dssp             ECCHHHHHHHHH-HHHHHH
T ss_pred             ecccHHHHHHHH-HHHHHH
Confidence            37977 588887 778875


No 16 
>PHA02781 hypothetical protein; Provisional
Probab=26.90  E-value=66  Score=20.78  Aligned_cols=26  Identities=23%  Similarity=0.396  Sum_probs=18.9

Q ss_pred             hhccCCccCCCCCcEEEEEeCCEEEEEec
Q psy1401          10 RIKVGGKTSNFGNAVSLERQKTKVILTAD   38 (79)
Q Consensus        10 rIKV~gk~gnlg~~V~v~r~k~ki~v~s~   38 (79)
                      +|.|+.|.||   .|+|+-+-.+|++...
T Consensus         9 kitvdskign---vvtisynlekitidvt   34 (78)
T PHA02781          9 KITVDSKIGN---VVTISYNLEKITIDVT   34 (78)
T ss_pred             EEEeecccCc---EEEEEeeeEEEEEecC
Confidence            3456777666   7899888778887764


No 17 
>PF14651 Lipocalin_7:  Lipocalin / cytosolic fatty-acid binding protein family; PDB: 2F73_A 3B2L_A 3B2J_A 3STN_A 3STK_A 3STM_X 3VG6_A 3VG4_A 3VG5_A 3B2K_A ....
Probab=26.80  E-value=1.1e+02  Score=21.03  Aligned_cols=39  Identities=13%  Similarity=0.169  Sum_probs=23.3

Q ss_pred             chHHHhhhhhccC----CccCCCCCcEEEEEeCCEEEEEecccc
Q psy1401           2 DMEKYLLERIKVG----GKTSNFGNAVSLERQKTKVILTADVAF   41 (79)
Q Consensus         2 ~fE~fL~erIKV~----gk~gnlg~~V~v~r~k~ki~v~s~~~f   41 (79)
                      |||.||. .|-|.    .+.-+..-.+.|+.+++..+++...|-
T Consensus        14 N~e~fmk-aiGvp~d~i~k~k~~k~v~Ei~q~Gd~ft~t~~~~g   56 (128)
T PF14651_consen   14 NFEEFMK-AIGVPEDKIQKGKDAKPVTEISQNGDDFTWTTTTPG   56 (128)
T ss_dssp             SHHHHHH-HCT--HHHHHHHTTS-EEEEEEEETTEEEEEEEETT
T ss_pred             CHHHHHH-HhCCCHHHHHhhhCCCceEEEEEeCCeEEEEEEecC
Confidence            6888873 23321    133344446889999998888765553


No 18 
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=26.75  E-value=29  Score=28.10  Aligned_cols=10  Identities=50%  Similarity=0.953  Sum_probs=8.2

Q ss_pred             hccccceeEE
Q psy1401          56 KNNLRDWLRV   65 (79)
Q Consensus        56 k~~LrdwlrV   65 (79)
                      -.|.||||+|
T Consensus       212 G~~iRDWl~V  221 (340)
T COG1088         212 GLQIRDWLYV  221 (340)
T ss_pred             CcceeeeEEe
Confidence            3689999987


No 19 
>PF07901 DUF1672:  Protein of unknown function (DUF1672);  InterPro: IPR012873 This family is composed of hypothetical bacterial proteins of unknown function. 
Probab=25.69  E-value=55  Score=25.73  Aligned_cols=41  Identities=24%  Similarity=0.396  Sum_probs=28.8

Q ss_pred             HHHhhhhhccCCccCCC-----CCcEEEEEeCCEEEEEeccccchH
Q psy1401           4 EKYLLERIKVGGKTSNF-----GNAVSLERQKTKVILTADVAFSKR   44 (79)
Q Consensus         4 E~fL~erIKV~gk~gnl-----g~~V~v~r~k~ki~v~s~~~fsKr   44 (79)
                      ++|+++.-+.+=|+.|.     |-.|-|++++.-|.-++.|||.+-
T Consensus        43 ~~yfkd~y~t~VKv~NVVga~dga~V~Veced~~I~F~aSv~~~~~   88 (277)
T PF07901_consen   43 IQYFKDNYKTDVKVTNVVGARDGAVVYVECEDHPIVFNASVPVDKD   88 (277)
T ss_pred             HHHHHHhcCceeEEEEEEccCCcEEEEEEecCCCceEEEEEEechh
Confidence            56777766555565553     225677887667999999999874


No 20 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=24.34  E-value=11  Score=21.12  Aligned_cols=16  Identities=38%  Similarity=0.862  Sum_probs=8.7

Q ss_pred             hHHHHHHHHHHhhhcc
Q psy1401          43 KRYLKYLTKKYLKKNN   58 (79)
Q Consensus        43 KrYlKYLtKKyLkk~~   58 (79)
                      +||.+++.++||..+.
T Consensus         1 eky~~~~~~~~~~~~~   16 (64)
T PF01485_consen    1 EKYQKFLLKRYLESDP   16 (64)
T ss_dssp             HCHHHCCCHS---S--
T ss_pred             ChHHHHHHHHHHHCCC
Confidence            4788888888885443


No 21 
>KOG4015|consensus
Probab=24.10  E-value=1.1e+02  Score=21.46  Aligned_cols=39  Identities=15%  Similarity=0.251  Sum_probs=25.4

Q ss_pred             chHHHhhhhhccC----CccCCCCCcEEEEEeCCEEEEEecccc
Q psy1401           2 DMEKYLLERIKVG----GKTSNFGNAVSLERQKTKVILTADVAF   41 (79)
Q Consensus         2 ~fE~fL~erIKV~----gk~gnlg~~V~v~r~k~ki~v~s~~~f   41 (79)
                      +|+.||.+- =|+    -.+..+...++|+.++++.++....-|
T Consensus        16 NFdeymk~l-GV~~~~Rk~a~~~kp~~~i~~~G~~~~~~t~Stf   58 (133)
T KOG4015|consen   16 NFDEYLKAL-GVGWATRKIAKLAKPVLEITQDGDKFTIKTLSTF   58 (133)
T ss_pred             CHHHHHHhc-CCcHhHHHHHhhcCCeEEEEEcCCEEEEEEeecc
Confidence            689998771 111    122333457889999999998875544


No 22 
>PF09386 ParD:  Antitoxin ParD;  InterPro: IPR018985  ParD is a plasmid anti-toxin than forms a ribbon-helix-helix DNA binding structure []. It stabilises plasmids by inhibiting ParE toxicity in cells that express ParD and ParE. ParD forms a dimer and also regulates its own promoter (parDE). ; PDB: 2AN7_A.
Probab=23.68  E-value=33  Score=22.54  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=9.5

Q ss_pred             chHHHhhhhhccCCccCCCC
Q psy1401           2 DMEKYLLERIKVGGKTSNFG   21 (79)
Q Consensus         2 ~fE~fL~erIKV~gk~gnlg   21 (79)
                      +++.||.+||. +|.+|++.
T Consensus        48 eL~~lL~~Ri~-~g~~G~vs   66 (79)
T PF09386_consen   48 ELKALLGERIA-QGLAGKVS   66 (79)
T ss_dssp             HHCHHS-S----SS-SS--S
T ss_pred             HHHHHHHHHHH-HHHcCCCc
Confidence            46789999998 78888875


No 23 
>KOG2775|consensus
Probab=23.65  E-value=48  Score=27.25  Aligned_cols=25  Identities=44%  Similarity=0.711  Sum_probs=16.7

Q ss_pred             eccccchHHHHHHH-HHHhhh-ccccc
Q psy1401          37 ADVAFSKRYLKYLT-KKYLKK-NNLRD   61 (79)
Q Consensus        37 s~~~fsKrYlKYLt-KKyLkk-~~Lrd   61 (79)
                      ++.||++|||-+|. -|||.. ++|.|
T Consensus       330 gTLaFcrR~lDrlGetKyLmAlk~Lc~  356 (397)
T KOG2775|consen  330 GTLAFCRRWLDRLGETKYLMALKNLCD  356 (397)
T ss_pred             ccccccHHHHHHhhhHHHHHHHHhhhh
Confidence            46799999998874 246643 44444


No 24 
>PF04972 BON:  BON domain;  InterPro: IPR007055 The BON domain is typically ~60 residues long and has an alpha/beta predicted fold. There is a conserved glycine residue and several hydrophobic regions. This pattern of conservation is more suggestive of a binding or structural function rather than a catalytic function. Most proteobacteria seem to possess one or two BON-containing proteins, typically of the OsmY-type proteins; outside of this group the distribution is more disparate.  The OsmY protein is an Escherichia coli 20 kDa outer membrane or periplasmic protein that is expressed in response to a variety of stress conditions, in particular, helping to provide protection against osmotic shock. One hypothesis is that OsmY prevents shrinkage of the cytoplasmic compartment by contacting the phospholipid interfaces surrounding the periplasmic space. The domain architecture of two BON domains alone suggests that these domains contact the surfaces of phospholipids, with each domain contacting a membrane [].; PDB: 2L26_A 2KGS_A 2KSM_A.
Probab=22.70  E-value=1.6e+02  Score=16.53  Aligned_cols=43  Identities=12%  Similarity=0.181  Sum_probs=22.5

Q ss_pred             hhhhccCCccCCCCCcEEEEEeCCEEEEEecccc--chHHHHHHHHH
Q psy1401           8 LERIKVGGKTSNFGNAVSLERQKTKVILTADVAF--SKRYLKYLTKK   52 (79)
Q Consensus         8 ~erIKV~gk~gnlg~~V~v~r~k~ki~v~s~~~f--sKrYlKYLtKK   52 (79)
                      +++|.-++...+  ..|.|+..++.|+++..+|=  .++.+.-+...
T Consensus         5 ~~~L~~~~~~~~--~~i~v~v~~g~v~L~G~v~s~~~~~~a~~~a~~   49 (64)
T PF04972_consen    5 RAALRADPWLPD--SNISVSVENGVVTLSGEVPSQEQRDAAERLARS   49 (64)
T ss_dssp             --------CTT---TTEEEEEECTEEEEEEEESSCHHHHHHHHHHHC
T ss_pred             ccccccccccCC--CeEEEEEECCEEEEEeeCcHHHHHHhHHhhhcc
Confidence            344444442222  37899999999999998873  34444444433


No 25 
>PF03526 Microcin:  Colicin E1 (microcin) immunity protein;  InterPro: IPR003061  The structural and functional relationships among independently cloned segments of the plasmid ColE1 region that regulates and codes for colicin E1 (cea), immunity (imm) and the mitomycin C-induced lethality function (lys) have been analysed []. A model for the structure and expression of the colicin E1 operon has been proposed in which the cea and lys genes are expressed from a single inducible promoter that is controlled by the lexA repressor in response to the SOS system of Escherichia coli []. The imm gene lies between the cea and lys genes and is expressed by transcription in the opposite direction from a promoter located within the lys gene []. This arrangement indicates that the transcriptional units for all three genes overlap. It is proposed that the formation of anti-sense RNA may be an important element in the coordinate regulation of gene expression in this system [].  Hydropathy analysis of the imm gene products suggests that they have hydrophobic domains characteristic of membrane-associated proteins []. The microcin E1 immunity protein is able to protect a cell that harbours the plasmid ColE1 encoding colicin E1 against colicin E1; it is thus essential both for autonomous replication and colicin E1 immunity []. ; GO: 0015643 toxin binding, 0030153 bacteriocin immunity
Probab=22.67  E-value=62  Score=19.96  Aligned_cols=18  Identities=33%  Similarity=0.475  Sum_probs=12.2

Q ss_pred             cccchHHHHHHHHHHhhh
Q psy1401          39 VAFSKRYLKYLTKKYLKK   56 (79)
Q Consensus        39 ~~fsKrYlKYLtKKyLkk   56 (79)
                      -||||+++....=||-++
T Consensus        20 ~PfSk~aIE~ialkft~k   37 (55)
T PF03526_consen   20 FPFSKWAIEKIALKFTKK   37 (55)
T ss_pred             hhhHHHHHHHHHHHhccH
Confidence            389999876655555544


No 26 
>PF08490 DUF1744:  Domain of unknown function (DUF1744);  InterPro: IPR013697 This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 from INTERPRO and IPR006134 from INTERPRO. ; GO: 0003887 DNA-directed DNA polymerase activity, 0008270 zinc ion binding, 0006260 DNA replication, 0005634 nucleus
Probab=21.42  E-value=2.7e+02  Score=22.43  Aligned_cols=47  Identities=21%  Similarity=0.481  Sum_probs=36.0

Q ss_pred             CCCCcEEEEEeCCEEEEEeccc---cchHHHHHHHHHHhhhccccceeEEEe
Q psy1401          19 NFGNAVSLERQKTKVILTADVA---FSKRYLKYLTKKYLKKNNLRDWLRVVA   67 (79)
Q Consensus        19 nlg~~V~v~r~k~ki~v~s~~~---fsKrYlKYLtKKyLkk~~LrdwlrVva   67 (79)
                      .||-.| |-.+-++|.|.+..+   =..-|..|+.+. ++.+.|-.||.+-.
T Consensus       329 rlG~~V-VyA~~~riil~T~K~~~~~A~ay~~yi~~~-i~~~~lF~~l~l~~  378 (396)
T PF08490_consen  329 RLGSKV-VYADFNRIILCTGKTSLENAYAYVQYILKS-IRSRELFSWLDLKP  378 (396)
T ss_pred             HcCCEE-EEEcCCEEEEECCCCCHHHHHHHHHHHHHH-HhcccccccEEeEH
Confidence            456555 667789999998765   378999999985 66788999887643


No 27 
>PF03776 MinE:  Septum formation topological specificity factor MinE;  InterPro: IPR005527  Cytokinesis needs to be regulated spatially in order to ensure that it occurs between the daughter genomes. In prokaryotes such as Escherichia coli, cytokinesis is initiated by FtsZ, a tubulin-like protein that assembles into a ring structure at the cell centre called the Z ring. A fundamental problem in prokaryotic cell biology is to understand how the midcell division site is identified. Two major negative regulatory systems are known to be involved in preventing Z-ring assembly at all sites except the midcell. One of these systems, called nucleoid occlusion, blocks Z-ring assembly in the area occupied by an unsegregated nucleoid until a critical stage in chromosome replication or segregation is reached. The other system consists of three proteins, MinC, MinD and MinE, which prevent assembly of Z rings in regions of the cell not covered by the nucleoid, such as the cell poles. MinC is an inhibitor of FtsZ polymerisation, resulting in the inhibition of Z ring assembly in the cell; MinD greatly enhances the inhibitory effects of MinC in vivo; and MinE antagonizes the effects of MinC and MinD [].   MinE is a small bifunctional protein. The amino terminus of MinE is required to interact with MinD, while the carboxyl terminus is required for `topological specificity' - that is, the ability of MinE to antagonise MinCD inhibition of Z rings at the midcell position but not at the poles.; GO: 0032955 regulation of barrier septum formation, 0051301 cell division; PDB: 2KXO_A 3MCD_B 3KU7_A 3R9J_C 3R9I_E 1EV0_B.
Probab=20.33  E-value=1.3e+02  Score=18.44  Aligned_cols=21  Identities=29%  Similarity=0.556  Sum_probs=16.0

Q ss_pred             cEEEEEeCCEEEEEeccccch
Q psy1401          23 AVSLERQKTKVILTADVAFSK   43 (79)
Q Consensus        23 ~V~v~r~k~ki~v~s~~~fsK   43 (79)
                      .|.++++++--.+.+++|+.+
T Consensus        50 ~v~l~~~~~~~~L~~nIpl~~   70 (70)
T PF03776_consen   50 EVQLERDDDMSVLEANIPLPR   70 (70)
T ss_dssp             EEEEEECTTEEEEEEEEEE--
T ss_pred             EEEEEECCCceEEEEEEEcCC
Confidence            677888888888889999863


Done!