Query         psy14016
Match_columns 71
No_of_seqs    102 out of 187
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 17:23:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14016.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14016hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4068|consensus              100.0 3.4E-35 7.4E-40  202.3   4.9   69    3-71      1-69  (174)
  2 PF05871 ESCRT-II:  ESCRT-II co 100.0 2.6E-35 5.6E-40  197.4   1.9   64    8-71      1-64  (139)
  3 KOG2911|consensus               70.5       6 0.00013   31.4   3.5   31   20-50     33-63  (439)
  4 PF03931 Skp1_POZ:  Skp1 family  68.5       3 6.4E-05   23.7   1.1   11   34-44     51-61  (62)
  5 KOG1724|consensus               55.3     7.8 0.00017   26.7   1.5   12   34-45     57-68  (162)
  6 PF12854 PPR_1:  PPR repeat      46.8      18 0.00039   18.0   1.7   16   30-45      8-23  (34)
  7 smart00512 Skp1 Found in Skp1   40.5      19 0.00042   21.9   1.5   15   34-48     55-69  (104)
  8 PF15630 CENP-S:  Kinetochore c  37.9      35 0.00075   20.7   2.3   27   26-52     39-65  (76)
  9 PF12856 Apc9:  Anaphase-promot  36.1      42  0.0009   21.5   2.5   26    7-35     30-55  (100)
 10 PF00922 Phosphoprotein:  Vesic  31.4      51  0.0011   24.9   2.7   24   26-49    128-151 (283)
 11 PF03617 IBV_3A:  IBV 3A protei  31.0      46   0.001   19.4   1.9   16   29-44     13-28  (57)
 12 TIGR00756 PPR pentatricopeptid  28.1      45 0.00098   15.0   1.3   15   31-45      2-16  (35)
 13 PF02177 APP_N:  Amyloid A4 N-t  26.0      39 0.00084   21.9   1.1    9   35-43     39-47  (102)
 14 PF01535 PPR:  PPR repeat;  Int  24.1      50  0.0011   14.7   1.1   14   31-44      2-15  (31)
 15 PF01843 DIL:  DIL domain;  Int  22.7      57  0.0012   19.8   1.4   26   22-47     26-51  (105)
 16 PRK13679 hypothetical protein;  22.3      93   0.002   20.4   2.4   42   12-53     31-72  (168)
 17 PF01510 Amidase_2:  N-acetylmu  21.1 1.4E+02   0.003   18.1   2.9   23   24-46     88-110 (132)
 18 PF13702 Lysozyme_like:  Lysozy  20.1 1.2E+02  0.0026   20.9   2.7   21   27-47      3-23  (160)

No 1  
>KOG4068|consensus
Probab=100.00  E-value=3.4e-35  Score=202.25  Aligned_cols=69  Identities=46%  Similarity=0.897  Sum_probs=67.0

Q ss_pred             CCCCCCCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHhhCceeeeccCcCCCCCCCCccccccCCCC
Q psy14016          3 DVQWPWQYNFPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEADNTALFFNPAISSILYAH   71 (71)
Q Consensus         3 ~f~~P~~y~fPPffT~Qpn~~Tr~kQl~~W~~lIl~y~~~~~~~~l~~~~~~~~~lF~N~~I~R~L~~e   71 (71)
                      .|+|||+|+||||||+|||.+||++|+++|++||++||||+|++.|+++++.+||||+|++|+|+||.|
T Consensus         1 ~f~wPw~Y~FPPffT~Qpn~~Tr~qQl~aW~~lil~ycr~~k~~smsI~~~~~s~LfnN~~l~R~Ls~~   69 (174)
T KOG4068|consen    1 MFAWPWQYSFPPFFTRQPNSNTRQQQLAAWIDLILQYCRHNKIWSMSIDEAQESPLFNNEKLQRRLSQE   69 (174)
T ss_pred             CCCCCcccCCCCceeecCCchhHHHHHHHHHHHHHHHHHhcCeEEEEecchhcccccchHHHhccCCHH
Confidence            489999999999999999999999999999999999999999999999999999999999999999964


No 2  
>PF05871 ESCRT-II:  ESCRT-II complex subunit;  InterPro: IPR008570 This entry represents the vps25 subunit (vacuolar protein sorting-associated protein 25) of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT (ESCRT-I, -II, -III) complexes orchestrate efficient sorting of ubiquitinated transmembrane receptors to lysosomes via multivesicular bodies (MVBs) []. ESCRT-II recruits the transport machinery for protein sorting at MVB []. In addition, the human ESCRT-II has been shown to form a complex with RNA polymerase II elongation factor ELL in order to exert transcriptional control activity. ESCRT-II transiently associates with the endosomal membrane and thereby initiates the formation of ESCRT-III, a membrane-associated protein complex that functions immediately downstream of ESCRT-II during sorting of MVB cargo. ESCRT-II in turn functions downstream of ESCRT-I, a protein complex that binds to ubiquitinated endosomal cargo []. ESCRT-II is a trilobal complex composed of two copies of vps25, one copy of vps22 and the C-terminal region of vps36. The crystal structure of vps25 revealed two winged-helix domains, the N-terminal domain of vps25 interacting with vps22 and vps35 [].; PDB: 1W7P_B 1U5T_D 1XB4_D 3HTU_E 3CUQ_C 2ZME_D.
Probab=100.00  E-value=2.6e-35  Score=197.44  Aligned_cols=64  Identities=50%  Similarity=0.892  Sum_probs=56.8

Q ss_pred             CCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHhhCceeeeccCcCCCCCCCCccccccCCCC
Q psy14016          8 WQYNFPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEADNTALFFNPAISSILYAH   71 (71)
Q Consensus         8 ~~y~fPPffT~Qpn~~Tr~kQl~~W~~lIl~y~~~~~~~~l~~~~~~~~~lF~N~~I~R~L~~e   71 (71)
                      |+|+||||||+|||++||++|+++|++|||+||||||+++|++.++.++|||+|++|||+|++|
T Consensus         1 ~~y~FPPFfT~Qpn~~Tr~~Ql~~W~~lIl~y~~~~k~~~l~~~e~~~~~lF~N~~I~R~L~~e   64 (139)
T PF05871_consen    1 WIYSFPPFFTLQPNPETREKQLELWSDLILDYCRHHKIFRLSLSEALESPLFNNESINRRLSPE   64 (139)
T ss_dssp             GGGGSGGGGS--SSHHHHHHHHHHHHHHHHHHHHHTT-SEEECHHHHCCCTTEETTTTEE--HH
T ss_pred             CccCCCCcceecCCHHHHHHHHHHHHHHHHHHHHHhceeeeecccccCCCCccCccccCCCCHH
Confidence            6899999999999999999999999999999999999999999988889999999999999864


No 3  
>KOG2911|consensus
Probab=70.50  E-value=6  Score=31.43  Aligned_cols=31  Identities=32%  Similarity=0.605  Sum_probs=27.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhhCceeeec
Q psy14016         20 PNEETRKKQLEAWRDLVLEYHKKTKTCIIDI   50 (71)
Q Consensus        20 pn~~Tr~kQl~~W~~lIl~y~~~~~~~~l~~   50 (71)
                      -|++-+..=+..|.++|+.||+..+..++++
T Consensus        33 ~n~~gydak~~fWrdlI~~~s~~~g~~if~~   63 (439)
T KOG2911|consen   33 LNPEGYDAKMNFWRDLILKYSRKSGRRIFLV   63 (439)
T ss_pred             cChHhHHhHhhHHHHHHHHHhhhcCCeEeeH
Confidence            3567789999999999999999999988883


No 4  
>PF03931 Skp1_POZ:  Skp1 family, tetramerisation domain;  InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex []. It was found to bind several F-box containing proteins (e.g., Cdc4, Skp2, cyclin F) and to be involved in the ubiquitin protein degradation pathway. A yeast homologue of SKP1 (P52286) was identified in the centromere bound kinetochore complex [] and is also involved in the ubiquitin pathway []. In Dictyostelium discoideum (Slime mold) FP21 was shown to be glycosylated in the cytosol and has homology to SKP1 []. This entry represents a POZ domain with a core structure consisting of beta(2)/alpha(2)/beta(2)/alpha(2) in two layers, alpha/beta. This domain is found at the N-terminal of SKP1 proteins [] as well as in subunit D of the centromere DNA-binding protein complex Cbf3 []. ; GO: 0006511 ubiquitin-dependent protein catabolic process; PDB: 1LM8_C 2XAI_E 1VCB_E 3ZRC_K 3ZRF_E 3DCG_B 2C9W_C 1LQB_B 2IZV_C 1HV2_A ....
Probab=68.54  E-value=3  Score=23.70  Aligned_cols=11  Identities=27%  Similarity=0.477  Sum_probs=8.9

Q ss_pred             HHHHHHHHhhC
Q psy14016         34 DLVLEYHKKTK   44 (71)
Q Consensus        34 ~lIl~y~~~~~   44 (71)
                      ..|++||.||+
T Consensus        51 ~kViewc~~H~   61 (62)
T PF03931_consen   51 KKVIEWCEHHK   61 (62)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHhcC
Confidence            35899999986


No 5  
>KOG1724|consensus
Probab=55.34  E-value=7.8  Score=26.65  Aligned_cols=12  Identities=42%  Similarity=0.565  Sum_probs=10.1

Q ss_pred             HHHHHHHHhhCc
Q psy14016         34 DLVLEYHKKTKT   45 (71)
Q Consensus        34 ~lIl~y~~~~~~   45 (71)
                      .+|+.||+||+-
T Consensus        57 ~kVIewC~~Hk~   68 (162)
T KOG1724|consen   57 KKVIEWCKKHKD   68 (162)
T ss_pred             HHHHHHHHHccc
Confidence            469999999984


No 6  
>PF12854 PPR_1:  PPR repeat
Probab=46.79  E-value=18  Score=18.02  Aligned_cols=16  Identities=19%  Similarity=0.341  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHhhCc
Q psy14016         30 EAWRDLVLEYHKKTKT   45 (71)
Q Consensus        30 ~~W~~lIl~y~~~~~~   45 (71)
                      -+|..||..|||.-++
T Consensus         8 ~ty~~lI~~~Ck~G~~   23 (34)
T PF12854_consen    8 VTYNTLIDGYCKAGRV   23 (34)
T ss_pred             hHHHHHHHHHHHCCCH
Confidence            3588999999998764


No 7  
>smart00512 Skp1 Found in Skp1 protein family. Family of Skp1 (kinetochore protein required for cell cycle progression) and elongin C (subunit of RNA polymerase II transcription factor SIII) homologues.
Probab=40.50  E-value=19  Score=21.94  Aligned_cols=15  Identities=20%  Similarity=0.138  Sum_probs=12.0

Q ss_pred             HHHHHHHHhhCceee
Q psy14016         34 DLVLEYHKKTKTCII   48 (71)
Q Consensus        34 ~lIl~y~~~~~~~~l   48 (71)
                      ..|++||.+|+-+..
T Consensus        55 ~~Vi~yc~~h~~~~~   69 (104)
T smart00512       55 SKVIEYCEHHVDDPP   69 (104)
T ss_pred             HHHHHHHHHcccCCC
Confidence            579999999986643


No 8  
>PF15630 CENP-S:  Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C.
Probab=37.86  E-value=35  Score=20.66  Aligned_cols=27  Identities=22%  Similarity=0.304  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHHHHhhCceeeeccC
Q psy14016         26 KKQLEAWRDLVLEYHKKTKTCIIDIQE   52 (71)
Q Consensus        26 ~kQl~~W~~lIl~y~~~~~~~~l~~~~   52 (71)
                      =+|++.|+.=+..+|+|-+--+|+.+|
T Consensus        39 ~~q~~~~a~DLe~FAkHA~R~tI~~dD   65 (76)
T PF15630_consen   39 YKQLENLAKDLEAFAKHAGRSTINMDD   65 (76)
T ss_dssp             HHHHHHHHHHHHHHHHHTT-SEE-HHH
T ss_pred             HHHHHHHHHHHHHHHHhcCCCeecHHH
Confidence            478999999999999999999998776


No 9  
>PF12856 Apc9:  Anaphase-promoting complex subunit 9;  InterPro: IPR024274  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. All APC subunits are members of the cullin family proteins, which bind to a ring-finger subunit via a conserved cullin domain [].The APC can be divided in four parts, the third of which is a tetratricopeptide repeat arm (TPR) that contains multiple subunits, including Apc9 []. This entry represents Apc9, one of the subunits of the anaphase-promoting complex.
Probab=36.07  E-value=42  Score=21.54  Aligned_cols=26  Identities=23%  Similarity=0.594  Sum_probs=20.5

Q ss_pred             CCCCCCCCCccccCCHHHHHHHHHHHHHH
Q psy14016          7 PWQYNFPPFFTLQPNEETRKKQLEAWRDL   35 (71)
Q Consensus         7 P~~y~fPPffT~Qpn~~Tr~kQl~~W~~l   35 (71)
                      ..-|+|-||..-   ...|+.|+.+|-+-
T Consensus        30 ~~~YDYs~F~~~---~~l~eSkI~~~l~s   55 (100)
T PF12856_consen   30 NSKYDYSPFSDK---NTLRESKIKAWLSS   55 (100)
T ss_pred             cCCCCcccccch---hHHHHHHHHHHHHH
Confidence            567999999665   44899999999753


No 10 
>PF00922 Phosphoprotein:  Vesiculovirus phosphoprotein;  InterPro: IPR000224 This entry contains phosphoprotein from vesiculoviruses, which are ssRNA negative-strand rhabdoviruses. It is known as the phosphoprotein or P protein [, ]. This protein may be part of the RNA dependent RNA polymerase complex []. The phosphorylation states of this protein may regulate the transcription and replication complexes [].; GO: 0003968 RNA-directed RNA polymerase activity; PDB: 2K47_A 3PMK_R 2FQM_F 3HHZ_C 3HHW_D.
Probab=31.36  E-value=51  Score=24.90  Aligned_cols=24  Identities=17%  Similarity=0.317  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHhhCceeee
Q psy14016         26 KKQLEAWRDLVLEYHKKTKTCIID   49 (71)
Q Consensus        26 ~kQl~~W~~lIl~y~~~~~~~~l~   49 (71)
                      ..|+.+|.+=|.+.|..-|-|+|.
T Consensus       128 ~~Q~~QW~~tI~Al~~sskywnL~  151 (283)
T PF00922_consen  128 PEQLSQWTSTIEALVQSSKYWNLS  151 (283)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCS-GG
T ss_pred             HHHHHHHHHHHHHHHHHhcCccee
Confidence            479999999999999888888763


No 11 
>PF03617 IBV_3A:  IBV 3A protein ;  InterPro: IPR005214 The gene product of gene 3 from Infectious bronchitis virus (strain CL190). Currently, the function of this protein remains unknown.
Probab=31.00  E-value=46  Score=19.38  Aligned_cols=16  Identities=25%  Similarity=0.501  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHhhC
Q psy14016         29 LEAWRDLVLEYHKKTK   44 (71)
Q Consensus        29 l~~W~~lIl~y~~~~~   44 (71)
                      +-.|+.|+++.+|+--
T Consensus        13 illwcklvlscf~ecv   28 (57)
T PF03617_consen   13 ILLWCKLVLSCFRECV   28 (57)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4589999999988653


No 12 
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=28.15  E-value=45  Score=14.99  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHhhCc
Q psy14016         31 AWRDLVLEYHKKTKT   45 (71)
Q Consensus        31 ~W~~lIl~y~~~~~~   45 (71)
                      .|..+|..||+..+.
T Consensus         2 ~~n~li~~~~~~~~~   16 (35)
T TIGR00756         2 TYNTLIDGLCKAGRV   16 (35)
T ss_pred             cHHHHHHHHHHCCCH
Confidence            588899999987653


No 13 
>PF02177 APP_N:  Amyloid A4 N-terminal heparin-binding;  InterPro: IPR015849 Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [, ]. Mutations in APP or in proteins that process APP have been linked with early-onset, familial AD. Individuals with Down's syndrome carry an extra copy of chromosome 21, which contains the APP gene, and almost invariably develop amyloid plaques and Alzheimer's symptoms.  APP is important for the neurogenesis and neuronal regeneration, either through the intact protein, or through its many breakdown products []. APP consists of a large N-terminal extracellular region containing heparin-binding and copper-binding sites, a short hydrophobic transmembrane domain, and a short C-terminal intracellular domain. The N-terminal region is similar in structure to cysteine-rich growth factors and appears to function as a cell surface receptor, contributing to neurite growth, neuronal adhesion, axonogenesis and cell mobility []. APP acts as a kinesin I membrane receptor to mediate the axonal transport of beta-secretase and presenilin 1. The N-terminal domain can regulate neurite outgrowth through its binding to heparin and collagen I and IV, which are components of the extracellular matrix. APP is also coupled to apoptosis-inducing pathways, and is involved in copper homeostasis/oxidative stress through copper ion reduction, where copper-metallated APP induces neuronal death []. The C-terminal intracellular domain appears to be involved in transcription regulation through protein-protein interactions. APP can promote transcription activation through binding to APBB1/Tip60, and may bind to the adaptor protein FE65 to transactivate a wide variety of different promoters. APP can be processed by different sets of enzymes:    In the non-amyloidogenic (non-plaque-forming) pathway, APP is cleaved by alpha-secretase to yield a soluble N-terminal sAPP-alpha (neuroprotective) and a membrane-bound CTF-alpha. CTF-alpha is broken-down by presenilin-containing gamma-secretase to yield soluble p3 and membrane-bound AICD (nuclear signalling).  In the amyloidogenic pathway (plaque-forming), APP is broken down by beta-secretase to yield soluble sAPP-beta and membrane-bound CTF-beta. CTF-beta is broken down by gamma-secretase to yield soluble amyloid-beta and membrane-bound AICD. Amyloid-beta is required for neuronal function, but can aggregate to form amyloid plaques that seem to disrupt brain cells by clogging points of cell-cell contact.   This entry represents a heparin-binding domain found at the N-terminal of the extracellular domain, which is itself found at the N-terminal of amyloidogenic glycoproteins such as amyloid-beta precursor protein (APP, or A4). The core of the heparin-binding domain has an unusual disulphide-rich fold, consisting of a beta-x-alpha-beta-loop-beta topology [].  More information about these protein can be found at Protein of the Month: Amyloid-beta Precursor Protein [].; GO: 0005488 binding, 0016021 integral to membrane; PDB: 3KTM_E 1MWP_A 2FKL_A 1OWT_A.
Probab=25.98  E-value=39  Score=21.85  Aligned_cols=9  Identities=33%  Similarity=0.663  Sum_probs=7.2

Q ss_pred             HHHHHHHhh
Q psy14016         35 LVLEYHKKT   43 (71)
Q Consensus        35 lIl~y~~~~   43 (71)
                      =||+|||.-
T Consensus        39 eIL~YCrkv   47 (102)
T PF02177_consen   39 EILKYCRKV   47 (102)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHh
Confidence            589999764


No 14 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=24.07  E-value=50  Score=14.72  Aligned_cols=14  Identities=21%  Similarity=0.439  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHhhC
Q psy14016         31 AWRDLVLEYHKKTK   44 (71)
Q Consensus        31 ~W~~lIl~y~~~~~   44 (71)
                      .|..+|-.||+...
T Consensus         2 ~y~~li~~~~~~~~   15 (31)
T PF01535_consen    2 TYNSLISGYCKMGQ   15 (31)
T ss_pred             cHHHHHHHHHccch
Confidence            58889999987655


No 15 
>PF01843 DIL:  DIL domain;  InterPro: IPR018444 Dilute encodes a novel type of myosin heavy chain, with a tail, or C-terminal, region that has elements of both type II (alpha-helical coiled-coil) and type I (non-coiled-coil) myosin heavy chains. The DIL non alpha-helical domain is found in dilute myosin heavy chain proteins and other myosins. In mouse the dilute protein may play a role in the elaboration, maintenance, or function of cellular processes of melanocytes and neurons []. The MYO2 protein of Saccharomyces cerevisiae is implicated in vectorial vesicle transport and is homologous to the dilute protein over practically its entire length [].; PDB: 3MMI_B 2F6H_X.
Probab=22.73  E-value=57  Score=19.84  Aligned_cols=26  Identities=4%  Similarity=-0.096  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhCcee
Q psy14016         22 EETRKKQLEAWRDLVLEYHKKTKTCI   47 (71)
Q Consensus        22 ~~Tr~kQl~~W~~lIl~y~~~~~~~~   47 (71)
                      .-++..|+...-+.|.+||+.+++-.
T Consensus        26 ~~~~g~qi~~nls~l~~W~~~~~l~~   51 (105)
T PF01843_consen   26 SWSKGVQIRYNLSELEDWARSHGLEE   51 (105)
T ss_dssp             -HHHHHHHHHHHHHHHHCCCCTTSTT
T ss_pred             ccccHHHHHHHHHHHHHHHHhcccch
Confidence            35688999999999999999888654


No 16 
>PRK13679 hypothetical protein; Provisional
Probab=22.26  E-value=93  Score=20.41  Aligned_cols=42  Identities=21%  Similarity=0.337  Sum_probs=34.8

Q ss_pred             CCCCccccCCHHHHHHHHHHHHHHHHHHHHhhCceeeeccCc
Q psy14016         12 FPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEA   53 (71)
Q Consensus        12 fPPffT~Qpn~~Tr~kQl~~W~~lIl~y~~~~~~~~l~~~~~   53 (71)
                      .||..|++.--++-..|++...+.+-+.|+..+-+.+.+++.
T Consensus        31 v~pHITL~f~g~~~~~~~~~l~~~l~~~~~~~~pf~l~l~~~   72 (168)
T PRK13679         31 IPPHITLKEPFEISDEQLDSIVEELRAIASETKPFTLHVTKV   72 (168)
T ss_pred             CCCceEEecCCCCCHHHHHHHHHHHHHHHhcCCCEEEEEecc
Confidence            588999986445557789999999999999889899988775


No 17 
>PF01510 Amidase_2:  N-acetylmuramoyl-L-alanine amidase;  InterPro: IPR002502 Proteins families containing this domain include zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity 3.5.1.28 from EC This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the Bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.; GO: 0008745 N-acetylmuramoyl-L-alanine amidase activity, 0009253 peptidoglycan catabolic process; PDB: 2RKQ_A 2EAV_A 2EAX_B 2XZ4_A 3TRU_A 3NKW_B 3QS0_B 3NW3_C 2Z9N_C 3NNO_B ....
Probab=21.07  E-value=1.4e+02  Score=18.09  Aligned_cols=23  Identities=17%  Similarity=0.232  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhCce
Q psy14016         24 TRKKQLEAWRDLVLEYHKKTKTC   46 (71)
Q Consensus        24 Tr~kQl~~W~~lIl~y~~~~~~~   46 (71)
                      -=+.|+++-..|+...|+.+++-
T Consensus        88 ~t~~Q~~a~~~L~~~l~~~~~i~  110 (132)
T PF01510_consen   88 PTDAQIEALARLIADLCRRYGIP  110 (132)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTSEE
T ss_pred             CCHHHHHHHHHHHHHHHHHCCcC
Confidence            34689999999999999999866


No 18 
>PF13702 Lysozyme_like:  Lysozyme-like
Probab=20.12  E-value=1.2e+02  Score=20.86  Aligned_cols=21  Identities=19%  Similarity=0.262  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHhhCcee
Q psy14016         27 KQLEAWRDLVLEYHKKTKTCI   47 (71)
Q Consensus        27 kQl~~W~~lIl~y~~~~~~~~   47 (71)
                      ++...|..+|-+||+.+.+-.
T Consensus         3 ~~V~~y~~~V~k~a~e~gi~~   23 (160)
T PF13702_consen    3 EEVLQYRPMVEKYAKEYGIPE   23 (160)
T ss_pred             HHHHHHHHHHHHHHHHcCChh
Confidence            577899999999999998754


Done!