Diaphorina citri psyllid: psy14031

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MTLGDGVCTVFGDPHYRTFDGKFYSFQGSCKYQLTADCTGGAFSIRVTNDARDTKTSSWTKTVSIRIGDMKVNLGEKLRVKIDGQRVALPYDLPSKVIVTKTAESVLVETAIGIKVLWDGNSFLEVSAPAKFKILDRLCGLCGNFNGISSDDLTTKRGRVVTDANKFGASWRVGGRKACSRPNTENSVGLGGVRCNHRLPQRKYRDKKCKPLRSDVFSACHARLNHLMYFKSCLVDMCECPLKNCHCESFTAYARECSRLGVQLGDWRKLTGCHSGAPPR

cccccCEEEEEccccEEcccccEEECccccEEEEEECcccccEEEEEEEccccccccEEEEEEEEEEccEEEEEEcccEEEEccEEEEccCCccccEEEEEEEcEEEEEEcccEEEEEccccEEEEEEcccccccccEECcccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHccccccccccHHHcccccccHHHHHHHHccccccccccEEcHHHHHHHHHHHHccccccccccccccccccccc

*TLGDGVCTVFGDPHYRTFDGKFYSFQGSCKYQLTADCTGGAFSIRVTNDARDTKTSSWTKTVSIRIGDMKVNLGEKLRVKIDGQRVALPYDLPSKVIVTKTAESVLVETAIGIKVLWDGNSFLEVSAPAKFKILDRLCGLCGNFNGISSDDLTTKRGRVVTDANKFGASWRVGGRKACSRP****SVGLGGVRCNHRLPQRKYRDKKCKPLRSDVFSACHARLNHLMYFKSCLVDMCECPLKNCHCESFTAYARECSRLGVQLGDWRKLTGCHSGAPP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0090092 [BP]	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0044707 [BP]	single-multicellular organism process	probable	GO:0032501, GO:0008150, GO:0044699
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005578 [CC]	proteinaceous extracellular matrix	probable	GO:0005575, GO:0005576, GO:0044421, GO:0031012

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1lsh, chain B		probable	Alignment \| Template Structure