Query         psy14059
Match_columns 220
No_of_seqs    19 out of 21
Neff          2.4 
Searched_HMMs 46136
Date          Fri Aug 16 18:30:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy14059.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/14059hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03271 EB1:  EB1-like C-termi  47.6      11 0.00024   25.6   1.2   12   70-81      7-18  (43)
  2 PF06288 DUF1040:  Protein of u  32.6      20 0.00043   28.4   0.7   48   64-119    30-77  (86)
  3 PF12286 DUF3622:  Protein of u  27.3      32 0.00069   26.5   1.0   15  190-204    18-32  (71)
  4 PF08459 UvrC_HhH_N:  UvrC Heli  23.3      26 0.00057   29.4  -0.1   12   88-99    144-155 (155)
  5 PF10226 DUF2216:  Uncharacteri  20.9      85  0.0018   28.1   2.6   28   56-83     91-124 (195)
  6 PF09185 DUF1948:  Domain of un  18.3 1.3E+02  0.0028   25.4   3.0   64   45-110    30-93  (140)
  7 TIGR03751 conj_TIGR03751 conju  17.5      49  0.0011   27.4   0.3    8   96-103   108-115 (116)
  8 KOG4153|consensus               16.7      81  0.0018   30.2   1.6   30   94-123    26-55  (358)
  9 PF03270 DUF269:  Protein of un  15.4      90   0.002   25.9   1.4   26   90-116    84-118 (122)
 10 PF03980 Nnf1:  Nnf1 ;  InterPr  12.2 6.5E+02   0.014   19.0   6.2   21   75-97     35-55  (109)

No 1  
>PF03271 EB1:  EB1-like C-terminal motif;  InterPro: IPR004953 A group of microtubule-associated proteins called +TIPs (plus end tracking proteins), including EB1 (end-binding protein 1) family proteins, label growing microtubules ends specifically in diverse organisms and are implicated in spindle dynamics, chromosome segregation, and directing microtubules toward cortical sites. EB1 members have a bipartite composition: the N-terminal CH domain (IPR001715 from INTERPRO) mediates microtubule plus end localization and a C-terminal cargo binding domain (EB1-C) that captures cell polarity determinants. The EB1-C domain comprises a unique EB1-like sequence motif that acts as a binding site for other +TIP proteins. It interacts with the carboxy terminus of the adenomatous polyposis coli (APC) tumor suppressor, a well conserved +TIP phosphoprotein with a pivotal function in cell cycle regulation. Another binding partner of the EB1-C domain is the well conserved +TIP protein dynactin, a component of the large cytoplasmic dynein/dynactin complex [, , ]. The ~80-residue EB1-C domain starts with a long smoothly curved helix (alpha1), which is followed by a hairpin connection leading to a short second helix (alpha2) running antiparallel to alpha1. The two parallel alpha1 helices of the EB1-C domain dimer wrap around each other in a slightly left-handed supercoil. The two alpha2 helices run antiparallel to helices alpha1 and form a similar fork in the opposite orientation and rotated by 90 degrees. As a result, two helical segments from each monomer form a four-helix bundle. The side chain forming the hydrophobic core of this bundle are highly conserved [, , ]. Some protein known to contain an EB1-C domain are listed below:  Yeast protein BIM1. Fission yeast microtubule integrity protein mal3. Vertebrate microtubule-associated protein RP/EB family member 1 (EB1). Vertebrate microtubule-associated protein RP/EB family member 2 (EB2 or RP1). Vertebrate microtubule-associated protein RP/EB family member 3 (EBF3).  ; GO: 0008017 microtubule binding; PDB: 3TQ7_B 4E61_B 2HKQ_A 1YIG_B 3GJO_B 2HL5_B 1YIB_A 1WU9_A 1TXQ_B.
Probab=47.57  E-value=11  Score=25.64  Aligned_cols=12  Identities=42%  Similarity=0.725  Sum_probs=9.8

Q ss_pred             hHHHHHhhhhhH
Q psy14059         70 EDYYNKLSKLEE   81 (220)
Q Consensus        70 edYYnKL~~LE~   81 (220)
                      +=|||||..+|-
T Consensus         7 dFYf~KLR~IE~   18 (43)
T PF03271_consen    7 DFYFNKLRDIEI   18 (43)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            459999999874


No 2  
>PF06288 DUF1040:  Protein of unknown function (DUF1040);  InterPro: IPR009383 This family consists of several bacterial YihD proteins of unknown function [].; PDB: 2KO6_A.
Probab=32.65  E-value=20  Score=28.45  Aligned_cols=48  Identities=25%  Similarity=0.441  Sum_probs=30.0

Q ss_pred             HhhhcchHHHHHhhhhhHHHHHHHhhhhhccccccCCCchhhhhhHHHHHHHHhHH
Q psy14059         64 VKTRKTEDYYNKLSKLEEDQLIREARIREASHQVGIPQERVSVSSKAAQKYERDLE  119 (220)
Q Consensus        64 VK~KK~edYYnKL~~LE~eQ~~KE~~lRe~sHQfAIPgEKvv~~S~AAq~YEe~Le  119 (220)
                      +|--..-.|...|..|.++-|+=--+||.+.-.=.|||=|        ..||+++-
T Consensus        30 qkLa~eag~~~~l~~LtDdvLIYhLKMr~s~k~e~iPGlk--------KDye~DFK   77 (86)
T PF06288_consen   30 QKLAQEAGFDGPLEDLTDDVLIYHLKMRNSDKDEMIPGLK--------KDYEDDFK   77 (86)
T ss_dssp             HHHHHHTT-SS-TTS--HHHHHHHHHHHHHTTSSS-SS----------------HH
T ss_pred             HHHHHhcCCCCchhhccHHHHHHHHHhcCCCccCcCCccc--------hhhHHHHH
Confidence            4555566788999999999999999999999999999965        67777664


No 3  
>PF12286 DUF3622:  Protein of unknown function (DUF3622);  InterPro: IPR022069  This family of proteins is found in bacteria. Proteins in this family are typically between 72 and 107 amino acids in length. There is a conserved VSK sequence motif. 
Probab=27.29  E-value=32  Score=26.45  Aligned_cols=15  Identities=33%  Similarity=0.463  Sum_probs=12.2

Q ss_pred             CCceeeeeeccceee
Q psy14059        190 GDKEIVRKITATETT  204 (220)
Q Consensus       190 GD~EItRkITATETT  204 (220)
                      =--||||++|+.-|.
T Consensus        18 W~aEItR~vTsrkTv   32 (71)
T PF12286_consen   18 WTAEITRRVTSRKTV   32 (71)
T ss_pred             eeeeeeeeecCceeE
Confidence            345999999998874


No 4  
>PF08459 UvrC_HhH_N:  UvrC Helix-hairpin-helix N-terminal;  InterPro: IPR001162 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products []. The UvrC proteins contain 4 conserved regions: a central region which interacts with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases. Proteins that contain the UvrC homology region 1, IPR000305 from INTERPRO, are listed below:   Prokaryotic UvrC proteins.  Bacteriophage T4 END2 protein. Small subunit of ribonucleotide reductase enzyme. T4 TEV1 protein. Endonuclease specific to the thymidylate synthase (td) gene splice junction. Found in putative intron-homing endonucleases encoded by group I introns of fungi and phage. Mycobacterium hypothetical protein Y002. Exonuclease by similarity.  Bacillus subtilis hypothetical protein YURQ.  ; GO: 0003677 DNA binding, 0004518 nuclease activity, 0006289 nucleotide-excision repair; PDB: 3C65_A 2NRZ_A 2NRR_A 2NRX_A 2NRV_A 2NRT_A 2NRW_A.
Probab=23.30  E-value=26  Score=29.38  Aligned_cols=12  Identities=42%  Similarity=0.808  Sum_probs=10.5

Q ss_pred             hhhhhccccccC
Q psy14059         88 ARIREASHQVGI   99 (220)
Q Consensus        88 ~~lRe~sHQfAI   99 (220)
                      ++||...|.|||
T Consensus       144 q~irDEaHRFAI  155 (155)
T PF08459_consen  144 QRIRDEAHRFAI  155 (155)
T ss_dssp             HHHHHHHHHHCC
T ss_pred             HHHHHHHHhccC
Confidence            578899999998


No 5  
>PF10226 DUF2216:  Uncharacterized conserved proteins (DUF2216);  InterPro: IPR019359  Proteins in this entry are found in Metazoa and contain a coiled-coil domain. Some annotation suggests it might be PKR, the Hepatitis delta antigen-interacting protein A, but this could not be confirmed. 
Probab=20.94  E-value=85  Score=28.09  Aligned_cols=28  Identities=32%  Similarity=0.615  Sum_probs=23.4

Q ss_pred             CChhHHH------HHhhhcchHHHHHhhhhhHHH
Q psy14059         56 KEPEWTQ------AVKTRKTEDYYNKLSKLEEDQ   83 (220)
Q Consensus        56 ~etEWQk------~VK~KK~edYYnKL~~LE~eQ   83 (220)
                      -..|||+      +|=.+.-.-|-+||++||.-|
T Consensus        91 larEWQrFGryta~vmr~eV~~Y~~KL~eLE~kq  124 (195)
T PF10226_consen   91 LAREWQRFGRYTASVMRQEVAQYQQKLKELEDKQ  124 (195)
T ss_pred             HhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5678996      577888899999999998755


No 6  
>PF09185 DUF1948:  Domain of unknown function (DUF1948);  InterPro: IPR015268 Members of this family of Mycoplasma hypothetical proteins adopt a helical structure, with one central alpha-helix surrounded by five others, in a NusB-like fold. Their function has not, as yet, been determined []. ; PDB: 1Q8C_A.
Probab=18.25  E-value=1.3e+02  Score=25.38  Aligned_cols=64  Identities=22%  Similarity=0.373  Sum_probs=32.6

Q ss_pred             hhhccccccCCCChhHHHHHhhhcchHHHHHhhhhhHHHHHHHhhhhhccccccCCCchhhhhhHH
Q psy14059         45 ADMIKRDKIQKKEPEWTQAVKTRKTEDYYNKLSKLEEDQLIREARIREASHQVGIPQERVSVSSKA  110 (220)
Q Consensus        45 ~~~lk~k~~ke~etEWQk~VK~KK~edYYnKL~~LE~eQ~~KE~~lRe~sHQfAIPgEKvv~~S~A  110 (220)
                      |++|.-+...-+-.+||+.+-+-=+|.-+.-+..+|+.|+-.-..+  .+.---|.|-||---..|
T Consensus        30 a~fl~yd~~er~ln~wqk~ivk~fse~~~~f~~~ie~qq~~nq~ei--q~kynkisgkkidllt~a   93 (140)
T PF09185_consen   30 ADFLDYDTPERQLNDWQKEIVKVFSENCFSFQKKIENQQQRNQAEI--QSKYNKISGKKIDLLTKA   93 (140)
T ss_dssp             HHHHHT--TTT---HHHHHHHHHHHHHHHHHHHHHHHHHHH---S----------------HHHHH
T ss_pred             HHHHhcCCcccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHhcccccchhhHHHHH
Confidence            4577777777788999999998889998888888888776543332  233345778887655555


No 7  
>TIGR03751 conj_TIGR03751 conjugative transfer region lipoprotein, TIGR03751 family. Members of this protein family are found occasionally on plasmids. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=17.54  E-value=49  Score=27.39  Aligned_cols=8  Identities=50%  Similarity=0.825  Sum_probs=6.0

Q ss_pred             cccCCCch
Q psy14059         96 QVGIPQER  103 (220)
Q Consensus        96 QfAIPgEK  103 (220)
                      |||.|||.
T Consensus       108 QYAlPGEr  115 (116)
T TIGR03751       108 QYALPGER  115 (116)
T ss_pred             eeccCCCc
Confidence            77777775


No 8  
>KOG4153|consensus
Probab=16.74  E-value=81  Score=30.19  Aligned_cols=30  Identities=27%  Similarity=0.346  Sum_probs=24.4

Q ss_pred             cccccCCCchhhhhhHHHHHHHHhHHHhhc
Q psy14059         94 SHQVGIPQERVSVSSKAAQKYERDLEAAKK  123 (220)
Q Consensus        94 sHQfAIPgEKvv~~S~AAq~YEe~Le~~~~  123 (220)
                      -|-||||.=-|++||.|-.+-|+-++....
T Consensus        26 eh~fAipainvtsSstA~aaleaar~~~sp   55 (358)
T KOG4153|consen   26 EHKFAIPAINVTSSSTAVAALEAARDSKSP   55 (358)
T ss_pred             ccccccceeeeechHHHHHHHHHHHhccCC
Confidence            489999999999999996677776666554


No 9  
>PF03270 DUF269:  Protein of unknown function, DUF269;  InterPro: IPR004952 This family includes several proteins of unknown function. Members of this family may be involved in nitrogen fixation, since they are found within nitrogen fixation operons.; PDB: 3NJ2_B 3G7P_A.
Probab=15.35  E-value=90  Score=25.93  Aligned_cols=26  Identities=19%  Similarity=0.445  Sum_probs=18.1

Q ss_pred             hhhccccccCC--------CchhhhhhHH-HHHHHH
Q psy14059         90 IREASHQVGIP--------QERVSVSSKA-AQKYER  116 (220)
Q Consensus        90 lRe~sHQfAIP--------gEKvv~~S~A-Aq~YEe  116 (220)
                      || +.|-|+.+        |+|+++..++ ..+|-+
T Consensus        84 LR-DvHRFGF~SlekL~~~G~klv~~av~~i~~~pe  118 (122)
T PF03270_consen   84 LR-DVHRFGFESLEKLAEEGEKLVSKAVELIEKFPE  118 (122)
T ss_dssp             E--SGGG--BSSHHHHHHHHHHHHHHHHHHHHH-HH
T ss_pred             HH-HHHhcCCccHHHHHHHHHHHHHHHHHHHHHhHH
Confidence            44 89999988        8999999888 777754


No 10 
>PF03980 Nnf1:  Nnf1 ;  InterPro: IPR007128 NNF1 is an essential yeast gene required for proper spindle orientation, nucleolar and nuclear envelope structure and mRNA export [].
Probab=12.22  E-value=6.5e+02  Score=18.96  Aligned_cols=21  Identities=48%  Similarity=0.635  Sum_probs=16.0

Q ss_pred             HhhhhhHHHHHHHhhhhhccccc
Q psy14059         75 KLSKLEEDQLIREARIREASHQV   97 (220)
Q Consensus        75 KL~~LE~eQ~~KE~~lRe~sHQf   97 (220)
                      ||.+|  +.|+.|++.|...+.-
T Consensus        35 kLneL--d~Li~eA~~r~~~~~~   55 (109)
T PF03980_consen   35 KLNEL--DKLIEEAKERKNSGER   55 (109)
T ss_pred             HHHHH--HHHHHHHHHhHhcccc
Confidence            66666  4689999999887664


Done!