Diaphorina citri psyllid: psy14072

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MKTEEIFQENVKKPWQFFSSTKNHPQISSNSSQLFEVTEVCPGLLLCGATMVGRTNHPVTCIVNAAPELPDPPLADTIKTVKIHILDSATEPLDSYFDQVADLVQKIKDEGGCTLIHCVAGVSRSASLCLAYLIKYNQMNFHQAFHYLRSLRPCIRPNLGFFKQLINYEKRFYAESSVEIVYNAAAQTYIPSVYEEDYSNMLTYQ
cccHHHHHHcccccccccccccccccccccccccccccEECccEEEccHHHHccccccccEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccccccHHHHccccccc
*********************************LFEVTEVCPGLLLCGATMVGRTNHPVTCIVNAAPELPDPPLADTIKTVKIHILDSATEPLDSYFDQVADLVQKIKDEGGCTLIHCVAGVSRSASLCLAYLIKYNQMNFHQAFHYLRSLRPCIRPNLGFFKQLINYEKRFYAESSV*******AQTYIPSVYEEDYSNMLTYQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTEEIFQENVKKPWQFFSSTKNHPQISSNSSQLFEVTEVCPGLLLCGATMVGRTNHPVTCIVNAAPELPDPPLADTIKTVKIHILDSATEPLDSYFDQVADLVQKIKDEGGCTLIHCVAGVSRSASLCLAYLIKYNQMNFHQAFHYLRSLRPCIRPNLGFFKQLINYEKRFYAESSVEIVYNAAAQTYIPSVYEEDYSNMLTYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity protein phosphatase 14 Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.confidentQ9JLY7
Dual specificity protein phosphatase 14 Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.confidentO95147
Probable dual specificity protein phosphatase DDB_G0269404 Has a dual specificity toward Ser/Thr and Tyr-containing proteins.confidentQ55E39

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0035335 [BP]peptidyl-tyrosine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031305 [CC]integral to mitochondrial inner membraneprobableGO:0044464, GO:0031975, GO:0031304, GO:0043229, GO:0031301, GO:0031300, GO:0032592, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0008330 [MF]protein tyrosine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046328 [BP]regulation of JNK cascadeprobableGO:0070302, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0032872, GO:0009966, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0017017 [MF]MAP kinase tyrosine/serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0008138, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788, GO:0033549
GO:0043409 [BP]negative regulation of MAPK cascadeprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0010741, GO:0048523, GO:0043408
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005863 [CC]striated muscle myosin thick filamentprobableGO:0015629, GO:0030016, GO:0030017, GO:0043229, GO:0043228, GO:0044430, GO:0043226, GO:0005856, GO:0044446, GO:0032982, GO:0005859, GO:0016459, GO:0005737, GO:0044424, GO:0043234, GO:0036379, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016460, GO:0043292, GO:0044422, GO:0044449
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031974 [CC]membrane-enclosed lumenprobableGO:0005575
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ESB, chain A
Confidence level:very confident
Coverage over the Query: 35-195
View the alignment between query and template
View the model in PyMOL